DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18179 and zgc:100868

DIOPT Version :9

Sequence 1:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster
Sequence 2:XP_005164187.1 Gene:zgc:100868 / 554458 ZFINID:ZDB-GENE-040801-33 Length:654 Species:Danio rerio


Alignment Length:279 Identity:87/279 - (31%)
Similarity:136/279 - (48%) Gaps:34/279 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLFLLTLSVALAVVAASPGFNRTSLLPQVTISEGA--EGRIVNGYPAPEGKAPYIVGLLIRTDG 63
            ||:.::.:::.:|::        |....|:.:...|  ..|||.|..||.|..|:.|.|  :.||
Zfish     4 MKIHIVGVALTIALL--------TGCDAQLDVCGTAPLNSRIVGGQNAPVGAWPWQVSL--QRDG 58

  Fly    64 SNSAAVGAGTIIASDWILTAAHCL---TTDYVEIHYG-SNWGWNGAFRQSVRRDNFISHPNWPAE 124
            |:..   .|::|.:.||||||||.   :|..:.::.| .......::..|....|.|.|||:.::
Zfish    59 SHFC---GGSLINNQWILTAAHCFPNPSTTGLLVYLGLQKLASFESYSMSSAVSNIIKHPNYNSD 120

  Fly   125 -GGRDIGLIRTPS-VGFTDLINKVALPSFSEESDRFVDTWCVACGWGGMDNG-NLAD--WLQCMD 184
             ...||.|::..| |.|::.|..:.|.  :.:|..|..|.....|||....| :|..  .||.:.
Zfish   121 TEDNDITLLQLASTVSFSNYIRPICLA--ASDSTFFNGTLVWITGWGNTATGVSLPSPGTLQEVQ 183

  Fly   185 VQIISNSECEQSYGTVASTD--MCTRRTD-GKSSCGGDSGGPLVTHDNARLV--GVITFGSVDC- 243
            |.|:.|.:|...||....||  :|..... ||.||.||||||:|:...:..:  |:::||: .| 
Zfish   184 VPIVGNRKCNCLYGVSKITDNMVCAGLLQGGKDSCQGDSGGPMVSKQGSVWIQSGIVSFGT-GCA 247

  Fly   244 -HSGPSGYTRVTDYLGWIR 261
             .:.|..||||:.|..||:
Zfish   248 QPNFPGVYTRVSKYQSWIQ 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 79/236 (33%)
Tryp_SPc 40..263 CDD:238113 80/238 (34%)
zgc:100868XP_005164187.1 Tryp_SPc 36..265 CDD:214473 79/236 (33%)
Tryp_SPc 37..267 CDD:238113 80/238 (34%)
Tryp_SPc 331..509 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.