DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18179 and ctrl

DIOPT Version :9

Sequence 1:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001004582.1 Gene:ctrl / 447843 ZFINID:ZDB-GENE-040912-147 Length:261 Species:Danio rerio


Alignment Length:266 Identity:81/266 - (30%)
Similarity:128/266 - (48%) Gaps:22/266 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LLTLSVALAVVAASPGFNRTSLLPQVTISEGAEGRIVNGYPAPEGKAPYIVGLLIRTDGSNSAAV 69
            :|.:....|:||::.|....::.|.::    ...|||||..|..|..|:.|.|    ..||....
Zfish     1 MLWIISCFALVASTLGCGVPAIKPVIS----GYNRIVNGENAVSGSWPWQVSL----QQSNGFHF 57

  Fly    70 GAGTIIASDWILTAAHC-LTTDYVEIHYGSNWGWNGAFRQSVRRDNF---ISHPNWPAEG-GRDI 129
            ..|::|...|::||||| :...|..:..|.:  ..|:..:||:..:.   |:||.:.::. ..||
Zfish    58 CGGSLINQYWVVTAAHCRVQAGYHYVILGEH--DRGSSAESVQVKSIAKAITHPYYNSQNFNNDI 120

  Fly   130 GLIRTPS-VGFTDLINKVALPSFSEESDRFVDTWCVACGWGGMDNGNLADWLQCMDVQIISNSEC 193
            .|::..| ...|..|:.|.|.:.|.....  .|.||..|||...:.:....||...:.::|.::|
Zfish   121 TLLKLSSPAQLTSRISPVCLAASSTSIPS--GTRCVTTGWGKTGSTSSPRILQQTALPLLSPAQC 183

  Fly   194 EQSYGTVASTD-MCTRRTDGKSSCGGDSGGPLVTHDNAR--LVGVITFGSVDCH-SGPSGYTRVT 254
            :|.:|....|| |......|.|||.||||||||...:..  .||::::|:.||: ..|:.|.||:
Zfish   184 KQYWGQNRITDAMICAGASGVSSCQGDSGGPLVCESSGAWYQVGIVSWGTSDCNVRTPAVYARVS 248

  Fly   255 DYLGWI 260
            ....||
Zfish   249 YLRQWI 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 73/230 (32%)
Tryp_SPc 40..263 CDD:238113 74/231 (32%)
ctrlNP_001004582.1 Tryp_SPc 31..254 CDD:214473 73/230 (32%)
Tryp_SPc 32..257 CDD:238113 74/231 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.