DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18179 and CTRB2

DIOPT Version :9

Sequence 1:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001020371.3 Gene:CTRB2 / 440387 HGNCID:2522 Length:263 Species:Homo sapiens


Alignment Length:241 Identity:82/241 - (34%)
Similarity:118/241 - (48%) Gaps:34/241 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RIVNGYPAPEGKAPYIVGLLIRTDGSNSAAVGAGTIIASDWILTAAHC--LTTDYVEIHYGSNWG 101
            |||||..|..|..|:.|.|..:| |.:..   .|::|:.||::|||||  .|:|.|..       
Human    33 RIVNGEDAVPGSWPWQVSLQDKT-GFHFC---GGSLISEDWVVTAAHCGVRTSDVVVA------- 86

  Fly   102 WNGAFRQSVRRDNF--------ISHPNWP-AEGGRDIGLIR--TPSVGFTDLINKVALPSFSEES 155
              |.|.|....:|.        ..:|.:. .....||.|::  ||: .|:..::.|.||  |.:.
Human    87 --GEFDQGSDEENIQVLKIAKVFKNPKFSILTVNNDITLLKLATPA-RFSQTVSAVCLP--SADD 146

  Fly   156 DRFVDTWCVACGWGGMD-NGN-LADWLQCMDVQIISNSECEQSYGTVASTDMCTRRTDGKSSCGG 218
            |....|.|...|||... |.| ..|.||...:.::||:||::|:|...:..|......|.|||.|
Human   147 DFPAGTLCATTGWGKTKYNANKTPDKLQQAALPLLSNAECKKSWGRRITDVMICAGASGVSSCMG 211

  Fly   219 DSGGPLVTH-DNA-RLVGVITFGSVDCH-SGPSGYTRVTDYLGWIR 261
            |||||||.. |.| .|||::::||..|. :.|:.|.||...:.|::
Human   212 DSGGPLVCQKDGAWTLVGIVSWGSRTCSTTTPAVYARVAKLIPWVQ 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 81/238 (34%)
Tryp_SPc 40..263 CDD:238113 81/240 (34%)
CTRB2NP_001020371.3 Tryp_SPc 33..256 CDD:214473 81/238 (34%)
Tryp_SPc 34..259 CDD:238113 81/240 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.