DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18179 and Jon99Ci

DIOPT Version :9

Sequence 1:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster


Alignment Length:241 Identity:103/241 - (42%)
Similarity:152/241 - (63%) Gaps:11/241 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 GAEGRIVNGYPAPEGKAPYIVGLLIRTDGSNSAAVGAGTIIASDWILTAAHCLT-TDYVEIHYGS 98
            |.||||.||..|.||:.|||||:.:.::| |....| |:||...|:||||||.. .|...::||:
  Fly    36 GIEGRITNGNLASEGQVPYIVGVSLNSNG-NWWWCG-GSIIGHTWVLTAAHCTAGADEASLYYGA 98

  Fly    99 -NWGWNGAFRQSVRRDNFISHPNWPAEGGRDIGLIRTPSVGFTDLINKVALPSFSEESDRFVDTW 162
             |:. ..|||.:|..:|||.:|::... ..|:.||:||.|.|..|:||:.|||..:..:.:.:.|
  Fly    99 VNYN-EPAFRHTVSSENFIRYPHYVGL-DHDLALIKTPHVDFYSLVNKIELPSLDDRYNSYENNW 161

  Fly   163 CVACGWGGM-DNGNLADWLQCMDVQIISNSECEQSYGTVASTD--MCTRRTDGKSSCGGDSGGPL 224
            ..|.|||.: |..|:.:.|:.:|:::||.:||:..|||..:::  :|....|||::|.|||||||
  Fly   162 VQAAGWGAIYDGSNVVEDLRVVDLKVISVAECQAYYGTDTASENTICVETPDGKATCQGDSGGPL 226

  Fly   225 VTHDNARLVGVITFGSV-DCH-SGPSGYTRVTDYLGWIRDNTGISY 268
            ||.:..:|:|:.:|.|. .|. .||:|:||||.||.||::.|||.|
  Fly   227 VTKEGDKLIGITSFVSAYGCQVGGPAGFTRVTKYLEWIKEETGIYY 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 94/227 (41%)
Tryp_SPc 40..263 CDD:238113 95/229 (41%)
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 94/227 (41%)
Tryp_SPc 41..266 CDD:238113 95/228 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470815
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.950

Return to query results.
Submit another query.