DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18179 and CG11843

DIOPT Version :9

Sequence 1:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster


Alignment Length:287 Identity:84/287 - (29%)
Similarity:121/287 - (42%) Gaps:68/287 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 GFNRTSLLPQVTISEGAEGR-----------IVNGYPAPEGKAPYIVGLLIRTDGSNSAAVGAGT 73
            ||    |||..:|    |.|           ||.|:||...:.|::..|..|.|.|:.|....|.
  Fly    45 GF----LLPGASI----ESRIIDNCRSYTPLIVGGHPAQPREFPHMARLGRRPDPSSRADWFCGG 101

  Fly    74 IIASD-WILTAAHCLTTDYVEIHYG--SNWGWNGAFRQSVRRD----NFISHPNW-PAEGGRDIG 130
            ::.|: ::|||||||.::..|::..  ....::.....:..||    .:|:||.: ..:...|||
  Fly   102 VLISERFVLTAAHCLESERGEVNVVRLGELDFDSLDEDAAPRDYMVAGYIAHPGYEDPQFYHDIG 166

  Fly   131 LIRTPSVGFTDLINKVALPSFSEE--SDRFVDTWCVACGWGGMDNGNLADWLQCMDVQIISNSEC 193
            |::.......||....|...|.:|  ||.|     :|.|||..... |....|.:.|::      
  Fly   167 LVKLTEAVVFDLYKHPACLPFQDERSSDSF-----IAVGWGSTGLA-LKPSAQLLKVKL------ 219

  Fly   194 EQSYGTVASTDMCTRRT-------DG-----------KSSCGGDSGGPLVTHDNAR-----LVGV 235
             |.||......:.||:.       ||           :.:|.|||||||:.:....     :|| 
  Fly   220 -QRYGNWVCKKLLTRQVEEFPRGFDGNNQLCVGSEMAQDTCNGDSGGPLLMYHREYPCMYVVVG- 282

  Fly   236 ITFGSVDCHSG--PSGYTRVTDYLGWI 260
            ||...:.|.|.  |..||||..|||||
  Fly   283 ITSAGLSCGSPGIPGIYTRVYPYLGWI 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 75/266 (28%)
Tryp_SPc 40..263 CDD:238113 76/256 (30%)
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 76/256 (30%)
Tryp_SPc 68..309 CDD:214473 74/254 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437121
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.