DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18179 and CG11841

DIOPT Version :9

Sequence 1:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster


Alignment Length:257 Identity:69/257 - (26%)
Similarity:107/257 - (41%) Gaps:42/257 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 GAEGRIVNGYPAPEGKAPYIVGLLIRTDGSNSAAVGAGTIIASDWILTAAHCLTTDYVEIHYGSN 99
            |:...||:|.||...:.|:...|..|...:.......||:|::..:||||||..:::.|:    |
  Fly    67 GSRPLIVDGTPAEPKEFPFAARLGHRKTNNEIKWFCGGTLISNRLVLTAAHCFFSEHGEV----N 127

  Fly   100 WGWNGAFRQSVRRDN----------FISHPNWP-AEGGRDIGLIRTP-SVGFTDLINKVALP-SF 151
            ....|........|:          ..:||.:. .:...|||:::.. .|.|....:...|| ..
  Fly   128 VVRLGELEFDTDTDDAEPEDFGVLALKAHPGFENPQLYNDIGIVQLDREVKFNRYKHPACLPFDD 192

  Fly   152 SEESDRFVDTWCVACGWGGMDNGN------LADWLQ-----CMDVQIISNSECEQSYGTVASTDM 205
            .|:.:.|     :|.|||......      |...||     |:. .:.:|.|....|  ...:.:
  Fly   193 GEQHESF-----IAIGWGQKKFAQKESKKLLKVQLQGYKDRCVS-SVDANDELPNGY--EPKSQL 249

  Fly   206 CTRRTDGKSSCGGDSGGPLVTH--DNARLVGV--ITFGSVDCHSG--PSGYTRVTDYLGWIR 261
            |....|.|.:|.||||||::.:  |.|.:..|  ||...:.|.:.  ||.||||..:|.||:
  Fly   250 CIGSRDNKDTCNGDSGGPVLAYHKDLACMYHVMGITSAGITCSTPDIPSAYTRVHYFLNWIK 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 66/250 (26%)
Tryp_SPc 40..263 CDD:238113 68/252 (27%)
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 67/250 (27%)
Tryp_SPc 72..310 CDD:214473 66/249 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437120
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.