DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18179 and CG10232

DIOPT Version :9

Sequence 1:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster


Alignment Length:291 Identity:62/291 - (21%)
Similarity:97/291 - (33%) Gaps:106/291 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RIVNGYPAPEGKAPYIVGLL-----IRTDGSNSAAVGAGTIIASDWILTAAHCLTTD-------- 90
            |:..|..|...:.|::..|:     :.|..:|.    :|::|...::||||||:..|        
  Fly   256 RMAYGTAARPNEYPWMAMLIYENRRLSTMTNNC----SGSLINKRYVLTAAHCVVKDKMVNTDLV 316

  Fly    91 ---------------------------------YVEIHYGSNWGWNGAFRQSVRRDNFISHPNWP 122
                                             |..:|           .|......|.|     
  Fly   317 LRRVRLGEHDITTNPDCDFTGNCAAPFVEIGIEYFNVH-----------EQYFNTSRFES----- 365

  Fly   123 AEGGRDIGLIR--TPSVGFTDLINKVALPSFSEESDRFVDTWCVACGWGGMDNGNLADWL----- 180
                 ||.|:|  || |.:|..|..:.:|   ::.....:......|||...|...:..|     
  Fly   366 -----DIALVRLQTP-VRYTHEILPICVP---KDPIPLHNHPLQIAGWGYTKNREYSQVLLHNTV 421

  Fly   181 -----QCMD-VQIISNSECEQSYGTVASTDMCTRRTDGKSSCGGDSGGPLVT------HDNARLV 233
                 .|.| :....|           .:.:|.....|:.||.|||||||:.      .|...|.
  Fly   422 YENRYYCQDKISFFRN-----------ESQICASGIRGEDSCEGDSGGPLMLTLNNDYQDIVYLA 475

  Fly   234 GVITFGSVDC-HSGPSGYTRVTDYLGWIRDN 263
            |::::||.:| ...|..||:...:..||:.|
  Fly   476 GIVSYGSENCGDRKPGVYTKTGAFFSWIKAN 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 59/286 (21%)
Tryp_SPc 40..263 CDD:238113 60/288 (21%)
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 60/285 (21%)
Tryp_SPc 260..503 CDD:214473 58/282 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435857
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.