DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18179 and SPE

DIOPT Version :9

Sequence 1:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_651168.1 Gene:SPE / 42791 FlyBaseID:FBgn0039102 Length:400 Species:Drosophila melanogaster


Alignment Length:237 Identity:59/237 - (24%)
Similarity:95/237 - (40%) Gaps:56/237 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 GTIIASDWILTAAHCLTTDYVEIHYGSNWGWNGAFRQSVRRDNF--------------------- 115
            |.::.|.::|||.|||.:..::        .:||...|||...:                     
  Fly   168 GALLNSRYVLTAGHCLASRELD--------KSGAVLHSVRLGEWDTRTDPDCTTQMNGQRICAPK 224

  Fly   116 ---------ISH----PNWPAEGGRDIGLIRTPS-VGFTDLINKVALPSFSEESDRFVDTWCVAC 166
                     |.|    || ..:...||.|:|... |.:||.:..:.||:.....:.|||......
  Fly   225 HIDIEVEKGIIHEMYAPN-SVDQRNDIALVRLKRIVSYTDYVRPICLPTDGLVQNNFVDYGMDVA 288

  Fly   167 GWGGMDNGNLADWLQCMDVQIISNSECEQSYGT----VASTDMCTRRTDGKSSCGGDSGGPLVT- 226
            |||..:|...:.....:.|.:.:.:.|::.|.:    :..:.||.....|..:|||||||||:. 
  Fly   289 GWGLTENMQPSAIKLKITVNVWNLTSCQEKYSSFKVKLDDSQMCAGGQLGVDTCGGDSGGPLMVP 353

  Fly   227 -----HDNARLVGVITFGSVDC--HSGPSGYTRVTDYLGWIR 261
                 .|...:.||.::|:..|  ...|..|||...::.||:
  Fly   354 ISTGGRDVFYIAGVTSYGTKPCGLKGWPGVYTRTGAFIDWIK 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 57/234 (24%)
Tryp_SPc 40..263 CDD:238113 59/237 (25%)
SPENP_651168.1 CLIP 42..94 CDD:314844
Tryp_SPc 135..397 CDD:238113 59/237 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435864
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.