DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18179 and CG16710

DIOPT Version :9

Sequence 1:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_651167.3 Gene:CG16710 / 42790 FlyBaseID:FBgn0039101 Length:372 Species:Drosophila melanogaster


Alignment Length:287 Identity:67/287 - (23%)
Similarity:103/287 - (35%) Gaps:94/287 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RIVNGYPAPEGKAPYIVGLLIRTDGSNS------AAVGAGTIIASDWILTAAHCLTTDYVEIHYG 97
            ||..|......:.|: :.|::....|.|      .:..||::|.:.::|||||||....:::.  
  Fly   105 RIFGGEETQPNELPW-MALILYAHRSRSVWNERLVSRCAGSLITNRYVLTAAHCLRITGLDLR-- 166

  Fly    98 SNWGWNGAFRQSVRRDNFISHPNWPAE-GGR------------------------------DIGL 131
                     |..:...|.:|:|:.... .||                              ||.|
  Fly   167 ---------RVRLGEHNILSNPDCVTHINGREHCAPEHLEIDVDLSIKHRHYMVFEERPYNDIAL 222

  Fly   132 IRTP-SVGFTDLINKVAL--------PSFSEESDRFVDTWCVACGWG-------------GMDNG 174
            :|.. .|.:|..|..:.:        ||||....:.       .|||             ...||
  Fly   223 LRLKFPVRYTAQIKPICVQLDYIFSNPSFSNHKLQI-------AGWGLSHKQGYSNVLLQAYVNG 280

  Fly   175 NLADWLQCMDVQIISNSECEQSYGTVASTDMCTRRTDGKSSCGGDSGGPLVT------HDNARLV 233
            ..||  :|        |..|.|.|....|.:|.....|..:|.|||||||:.      .:...|.
  Fly   281 RNAD--EC--------SLSEPSLGLDKETHICAGNLGGNDTCKGDSGGPLMAIMERGDEEFVYLA 335

  Fly   234 GVITFGSVDCHSGPSGYTRVTDYLGWI 260
            |:.::|...|..||:.||:.:.::.||
  Fly   336 GITSYGYSQCGYGPAAYTKTSKFVEWI 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 65/285 (23%)
Tryp_SPc 40..263 CDD:238113 66/286 (23%)
CG16710NP_651167.3 CLIP 35..84 CDD:288855
Tryp_SPc 105..362 CDD:214473 65/285 (23%)
Tryp_SPc 106..362 CDD:238113 64/284 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435858
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.