DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18179 and CG17475

DIOPT Version :9

Sequence 1:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster


Alignment Length:253 Identity:73/253 - (28%)
Similarity:110/253 - (43%) Gaps:37/253 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LPQVTISEGA--EGRIVNGYPAPEGKAPYIVGLLIRTDGSNSAAVGAGTIIASDWILTAAHCLTT 89
            |..::.:||.  :.|::||.....|:|.|.:.|    .|.....:..|.||....:||||||:  
  Fly    35 LEWISKAEGVNFQNRVINGEDVQLGEAKYQISL----QGMYGGHICGGCIIDERHVLTAAHCV-- 93

  Fly    90 DYVEIHYGSNWGWNGAFRQSVRRDN-----FIS----HPNWPA-EGGRDIGLIR-TPSVGFTDLI 143
                  ||.|..:......:|..:.     |:.    |.|:.: :...||.||| ..::.|.:..
  Fly    94 ------YGYNPTYLRVITGTVEYEKPDAVYFVEEHWIHCNYNSPDYHNDIALIRLNDTIKFNEYT 152

  Fly   144 NKVALPSFSEESDRFVDTWCVACGWGGMDN-GNLADWLQCMDVQIISNSECEQSYGTVAST---D 204
            ....||:....:    .|..:..|||..:. |:..|.||...:..:..|.|::......|.   .
  Fly   153 QPAELPTAPVAN----GTQLLLTGWGSTELWGDTPDILQKAYLTHVVYSTCQEIMNNDPSNGPCH 213

  Fly   205 MCTRRTDGKSSCGGDSGGPLVTHDNARLVGVITFGSVDCHSG-PSGYTRVTDYLGWIR 261
            :||..|.|:.:|.||||||| || |..|.|::.:| ..|..| |..:..|..||.|||
  Fly   214 ICTLTTGGQGACHGDSGGPL-TH-NGVLYGLVNWG-YPCALGVPDSHANVYYYLEWIR 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 67/236 (28%)
Tryp_SPc 40..263 CDD:238113 69/238 (29%)
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 67/236 (28%)
Tryp_SPc 50..269 CDD:238113 69/238 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436798
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.