DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18179 and CG31265

DIOPT Version :9

Sequence 1:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_650599.1 Gene:CG31265 / 42068 FlyBaseID:FBgn0051265 Length:266 Species:Drosophila melanogaster


Alignment Length:279 Identity:87/279 - (31%)
Similarity:131/279 - (46%) Gaps:42/279 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLFLLTLSVALAVVAASPGFNRTSLLPQVTISEGAEGRIVNGYPAPEGKAPYIVGL--LIRTDG 63
            |||..|:|.:.|||...:|..::..:.|   ...|..|||..|..|..|.|||.|.|  ::   |
  Fly     1 MKLLRLSLLILLAVKPPNPCESKRIVGP---FPAGQSGRIKGGEEAEIGFAPYQVSLQPIV---G 59

  Fly    64 SNSAAVGAGTIIASDWILTAAHCLTT---DYVEIHYGSN-WGWNGA--FRQSVRRDNFISHPNWP 122
            |::.   .|.|:..:||:||.||:..   ..|.:..|:| |...||  :...:.:......|.. 
  Fly    60 SHNC---GGAILNENWIITAGHCVENFIPALVNVITGTNKWAEPGAIYYTAEIHKHCMYDQPYM- 120

  Fly   123 AEGGRDIGLIR-TPSVGFTDLINKVALPS----FSEESDRFVDTWCVACGWGG-MDNGNLADWLQ 181
               ..||.|:: |.::.|.:|...:|||:    ..||        .|..|||. :..|:..:.|.
  Fly   121 ---HNDIALVKLTENITFNELTQPIALPTRPVQLGEE--------IVLTGWGSDVAYGSSMEDLH 174

  Fly   182 CMDVQIISNSECEQSYGTVAST---DMCTRRTDGKSSCGGDSGGPLVTHDNARLVGVITFGSVDC 243
            .:.|.::...||.:::...:|.   .:||...:|:.:|.||||||||:  |.:||||:.:|. .|
  Fly   175 KLTVGLVPLDECYETFNRTSSMGVGHICTFSREGEGACHGDSGGPLVS--NGQLVGVVNWGR-PC 236

  Fly   244 HSG-PSGYTRVTDYLGWIR 261
            ..| |.....|..||.|||
  Fly   237 GVGLPDVQANVYYYLDWIR 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 72/238 (30%)
Tryp_SPc 40..263 CDD:238113 74/240 (31%)
CG31265NP_650599.1 Tryp_SPc 36..254 CDD:214473 72/238 (30%)
Tryp_SPc 39..257 CDD:238113 73/238 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.