DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18179 and modSP

DIOPT Version :9

Sequence 1:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_536776.2 Gene:modSP / 42032 FlyBaseID:FBgn0051217 Length:628 Species:Drosophila melanogaster


Alignment Length:280 Identity:69/280 - (24%)
Similarity:106/280 - (37%) Gaps:75/280 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SPGFNRTSLLPQVTISEGA---EGR-----------------IVNGYPAPEGKAPYIVGLLIRTD 62
            |.||...|.||::...:|.   .||                 ...||.......|:.|||.:..:
  Fly   327 STGFKTLSPLPEMRCMKGGYWNRGRQRCEQDCGQLATPIKQFSSGGYTINNTVVPWHVGLYVWHN 391

  Fly    63 GSNSAAVGAGTIIASDWILTAAHCLTTDYVEIHYGSNWGWNGAFRQSVRRDNFISHPNW----PA 123
            ..:......|:::..|.::|||||:..:...:.|..:     .||....:    .:.|:    |.
  Fly   392 EKDYHFQCGGSLLTPDLVITAAHCVYDEGTRLPYSYD-----TFRVIAAK----FYRNYGETTPE 447

  Fly   124 EGGRDIGLI--------RTPSVGFTDL----------INKVALP------SFSEESDRFVDTWCV 164
            |..||:.||        ||.:. :.||          ::.|..|      ||:|:.....|....
  Fly   448 EKRRDVRLIEIAPGYKGRTENY-YQDLALLTLDEPFELSHVIRPICVTFASFAEKESVTDDVQGK 511

  Fly   165 ACGWGGMDNGNLADWLQCMDVQIISNSECEQSYGTVASTDMCTRRTDGKS-SCGGDSGGPLV--- 225
            ..|| .::|.:   .||.:.....|||.|.::...:.:...|. .|.||| :|.|||||...   
  Fly   512 FAGW-NIENKH---ELQFVPAVSKSNSVCRRNLRDIQADKFCI-FTQGKSLACQGDSGGGFTSEL 571

  Fly   226 ------THDNAR--LVGVIT 237
                  |.:.||  |.|||:
  Fly   572 PTNAFSTWNTARHFLFGVIS 591

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 61/256 (24%)
Tryp_SPc 40..263 CDD:238113 60/238 (25%)
modSPNP_536776.2 LDLa 27..58 CDD:197566
LDLa 70..101 CDD:197566
LDLa 123..157 CDD:197566
LDLa 167..199 CDD:238060
CCP <251..284 CDD:153056
Sushi 309..354 CDD:278512 9/26 (35%)
Tryp_SPc 371..616 CDD:214473 60/236 (25%)
Tryp_SPc 371..591 CDD:304450 59/234 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436794
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.