DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18179 and CG9649

DIOPT Version :9

Sequence 1:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster


Alignment Length:319 Identity:75/319 - (23%)
Similarity:112/319 - (35%) Gaps:109/319 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 PGFNRTSLLPQV---------------TISE--GAEGR--------IVNGYPAPEGKAPYIVGLL 58
            |.| :||..|.|               ||.:  |..||        |.||.....|:.|::..|.
  Fly   212 PEF-QTSARPSVHPSNTPAQASKFYPQTIGQLSGICGREKVIQTPFIHNGIEVERGQLPWMAALF 275

  Fly    59 IRTDGSNSAAVGAGTIIASDWILTAAHCLTTDYVEIHYGSNWGWNGAFRQSVRRDNFISHPNWPA 123
            ... |.:...:..||:|::..:::||||       ..:||.                    |.|.
  Fly   276 EHV-GRDYNFLCGGTLISARTVISAAHC-------FRFGSR--------------------NLPG 312

  Fly   124 E---------------GGRDIGLIR-------TPSVGFTDLINKVALPSFSEESD--RFVDTWCV 164
            |               .|..:|:.|       .|:| :||.  .:||...|...|  .::...|:
  Fly   313 ERTIVSLGRNSLDLFSSGATLGVARLLIHEQYNPNV-YTDA--DLALLQLSNHVDIGDYIKPICL 374

  Fly   165 ----------------ACGWGGMDNGNLADWLQCM-DVQIISNSEC-----EQSYGTVASTDMCT 207
                            ..|||..:.||....|..| |..||:..||     |::...:.|..:|.
  Fly   375 WNENFLLELPSGHKSYVAGWGEDEKGNRNTRLAKMTDTDIITQWECRGNLSEENAKFITSHTICA 439

  Fly   208 RRTDGKSSCGGDSGGPLV--THDNARLVGVITFG---SVDCH-SGPSGYTRVTDYLGWI 260
            ........|.|||||.|:  ..|...|.||::.|   :..|: :.|..||.|..::.|:
  Fly   440 SNAQASGPCSGDSGGGLMLQEQDIWMLRGVVSAGQRMTNRCNLTLPVIYTDVAKHIEWL 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 64/280 (23%)
Tryp_SPc 40..263 CDD:238113 64/273 (23%)
CG9649NP_650343.1 GD_N 29..124 CDD:292649
Tryp_SPc 257..498 CDD:238113 63/271 (23%)
Tryp_SPc 259..497 CDD:214473 62/268 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471100
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.