DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18179 and snk

DIOPT Version :9

Sequence 1:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster


Alignment Length:268 Identity:75/268 - (27%)
Similarity:115/268 - (42%) Gaps:42/268 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 FNRTSLLPQVTISEGAEGRIVNGYPAPEGKAPYIVGLLIRTDGSNS----AAVGAGTIIASD-WI 80
            |:....:|.|.:       ||.|.|...|..|::.. |..|.||.|    ...|.|..:.|: ::
  Fly   174 FSGKQCVPSVPL-------IVGGTPTRHGLFPHMAA-LGWTQGSGSKDQDIKWGCGGALVSELYV 230

  Fly    81 LTAAHCLTT-----DYVEIHYGSNWGWNGAFRQSVRRDNFISHPNWPAEG-GRDIGLIR-TPSVG 138
            ||||||.|:     |.|.:. ........|.:|.::....:.||.:.:.. ..||.|:: |..|.
  Fly   231 LTAAHCATSGSKPPDMVRLG-ARQLNETSATQQDIKILIIVLHPKYRSSAYYHDIALLKLTRRVK 294

  Fly   139 FTDLINKVALPSFSEESDRFVDTWCVACGWGGMD-NGNLADWLQCMDVQIISNSECEQSY----- 197
            |::.:....|....|.....|    ||.|||..: .|..::.|:.:|:.::....|:|.|     
  Fly   295 FSEQVRPACLWQLPELQIPTV----VAAGWGRTEFLGAKSNALRQVDLDVVPQMTCKQIYRKERR 355

  Fly   198 ---GTVASTDMCTRRTDGKSSCGGDSGGP---LVTHDN--ARLVGVITFGSVDC--HSGPSGYTR 252
               |.:...........|:.:|.||||||   |:...|  |.:||:.:||.. |  .:.|..|||
  Fly   356 LPRGIIEGQFCAGYLPGGRDTCQGDSGGPIHALLPEYNCVAFVVGITSFGKF-CAAPNAPGVYTR 419

  Fly   253 VTDYLGWI 260
            :..||.||
  Fly   420 LYSYLDWI 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 70/248 (28%)
Tryp_SPc 40..263 CDD:238113 72/249 (29%)
snkNP_001097766.1 CLIP 93..139 CDD:197829
Tryp_SPc 186..430 CDD:238113 72/249 (29%)
Tryp_SPc 186..427 CDD:214473 70/247 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436988
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.