DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18179 and CG14088

DIOPT Version :9

Sequence 1:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_649100.2 Gene:CG14088 / 40098 FlyBaseID:FBgn0036858 Length:289 Species:Drosophila melanogaster


Alignment Length:232 Identity:56/232 - (24%)
Similarity:86/232 - (37%) Gaps:38/232 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 EGKAPYIVGLLIRTDGSNSAAVGAGTIIASDWILTAAHCLTTDYVEIHYGSNWGWNGAFRQSVRR 112
            :|.:|.|||............||.||:|...:|||..||  .|.:.: ..:..|..|.....:..
  Fly    36 DGLSPDIVGPWTAILHHFGRIVGVGTLIHERFILTDVHC--GDSIGV-IRARLGEYGRIGSELAE 97

  Fly   113 DN----FISHPNW-PAEGGRDIGLIR-TPSVGFTDLINKVA------LPSFSEESDRF-VDTWCV 164
            |:    |.|:.|: |.....::||:: ..:|.:.:.|..|.      :.:|::|.|.| ..||  
  Fly    98 DHIVAAFFSNANFNPETQANNMGLMKLLRTVVYKEHIIPVCILMDSRMQTFADELDYFNGTTW-- 160

  Fly   165 ACGWGGMDNGNLADWLQCMDVQIISNSECEQSYGTVASTDMCTRRTDGKSSCGGDSGGPL----- 224
                   .|.:.:..|:...|     ....|:.|.:.....|....| ..||...||..|     
  Fly   161 -------KNSDKSPMLRSKTV-----IRMPQACGKLDHGQFCAGHKD-LDSCDEPSGAALTREID 212

  Fly   225 -VTHDNARLVGVITFGSVDCHSGPSGYTRVTDYLGWI 260
             :..:...|.|:.....|.| |....||.|.....||
  Fly   213 YIGPNRTVLFGIANSVEVKC-SNSRTYTDVVQLHQWI 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 54/230 (23%)
Tryp_SPc 40..263 CDD:238113 56/232 (24%)
CG14088NP_649100.2 Tryp_SPc 42..251 CDD:304450 54/226 (24%)
Tryp_SPc 42..248 CDD:214473 52/224 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.