DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18179 and CG11529

DIOPT Version :9

Sequence 1:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster


Alignment Length:250 Identity:84/250 - (33%)
Similarity:119/250 - (47%) Gaps:35/250 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 ISEGAEGRIVNGYPAPEGKAPYIVGLLIRTDGSNSAAVGAGTIIASDWILTAAHC-LTTDYVEIH 95
            :.:...|||        .|.||.| :||.........:..||::...|||||.|| :...:.:::
  Fly    30 VGQSKYGRI--------EKFPYQV-MLIGKQLWRKRILCGGTLLDKRWILTAGHCTMGVTHYDVY 85

  Fly    96 YGSNWGWNGAFRQSV-----------RRDNFISHPNW-PAEGGRDIGLIRTP-SVGFTDLINKVA 147
            .|:         :||           |.:.||.|..: |.....||.|::.| .|.||..|...:
  Fly    86 LGT---------KSVEDTEVSGGLVLRSNKFIVHERFNPETAANDIALVKLPQDVAFTPRIQPAS 141

  Fly   148 LPSFSEESDRFVDTWCVACGWGGMDNGNLADWLQCMDVQIISNSECEQSYGTVASTDMCTRRTDG 212
            ||| ....|:|.....||.|||.|.....:|.:|..::::|||:||.|.|..|.|..:|.:....
  Fly   142 LPS-RYRHDQFAGMSVVASGWGAMVEMTNSDSMQYTELKVISNAECAQEYDVVTSGVICAKGLKD 205

  Fly   213 KSSCGGDSGGPLVTHDNARLVGVITFGSVD-CHSG-PSGYTRVTDYLGWIRDNTG 265
            ::.|.||||||||..|...:||:.:||..| |.:. |.|:||||.||.||....|
  Fly   206 ETVCTGDSGGPLVLKDTQIVVGITSFGPADGCETNIPGGFTRVTHYLDWIESKIG 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 80/236 (34%)
Tryp_SPc 40..263 CDD:238113 81/238 (34%)
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 82/239 (34%)
Tryp_SPc 37..255 CDD:214473 80/236 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.