DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18179 and CG33465

DIOPT Version :9

Sequence 1:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster


Alignment Length:242 Identity:59/242 - (24%)
Similarity:94/242 - (38%) Gaps:57/242 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 APYIVGLLIRTDGSNSAAVGAGTIIASDWILTAAHCLTTD---------YVEIHYGSNWGWNGAF 106
            ||::..:.     .|:..:..||::...::||||.|::.|         |.:....|.:..|..:
  Fly    45 APWMASIY-----KNNQFICDGTLVHKLFVLTAASCISKDSQLYVLFGMYNQYRDASQFFNNEQY 104

  Fly   107 RQSVRRDNFISHPNW-PAEGGRDIGLIR-----------TPSVGFTDLINKVALPSFSEESDRFV 159
            ..:|.    :.|.|: |..|..||||:|           .|.....|.:.|      |...:||.
  Fly   105 GVAVA----LQHSNFRPNNGVNDIGLLRLYGEVTHYAHIRPICIILDHVVK------SAPFERFE 159

  Fly   160 DTWCVACGWGGMDNGNLADWLQCMDVQIISNS---ECEQSYGTVASTD--MCTRRTDGKSSCGGD 219
                   |:|....|..|. .|......:|..   ||.::...:...:  .|....| :|.|..:
  Fly   160 -------GFGWQQQGTEAS-SQVRQTVYLSQKKPFECHRNGQLLPINEGQFCAGNRD-RSFCRSN 215

  Fly   220 SGGPLV---THDNARL---VGVITFGSVDCHSGPSGYTRVTDYLGWI 260
            ||.||.   |:....:   ||::::||..| |..|.||.|..:..||
  Fly   216 SGSPLTADFTYGVKNITVQVGLVSYGSELC-SPTSVYTDVVAFKDWI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 57/240 (24%)
Tryp_SPc 40..263 CDD:238113 59/242 (24%)
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 58/241 (24%)
Tryp_SPc 46..261 CDD:214473 56/239 (23%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435881
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.