DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18179 and CG10472

DIOPT Version :9

Sequence 1:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster


Alignment Length:279 Identity:104/279 - (37%)
Similarity:140/279 - (50%) Gaps:17/279 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LFLLTLSVALAVVAAS-PGFNRTSLLPQVTISEGAEGRIVNGYPAPEGKAPYIVGLLIRTDGSNS 66
            |.|.|:..|.||...| ...|..:.:|:|.......|||..|..|...:.||.||||:...|  .
  Fly     9 LLLATILGAQAVDWNSVKNLNIETPMPKVHGETLPSGRITGGQIAEPNQFPYQVGLLLYITG--G 71

  Fly    67 AAVGAGTIIASDWILTAAHC---LTTD---YVEIHYGSNWGWNGAFRQSVRRDNFISHPNWPAEG 125
            ||...||||:..||:|||||   |||.   |:..|..:|....|.....|...|.|.|.:|.||.
  Fly    72 AAWCGGTIISDRWIITAAHCTDSLTTGVDVYLGAHDRTNAKEEGQQIIFVETKNVIVHEDWIAET 136

  Fly   126 -GRDIGLIRTP-SVGFTDLINKVALPSFSEESDRFVDTWCVACGWGGMDNG--NLADWLQCMDVQ 186
             ..||.||:.| .:.|...|....||..|:....:.....:|.|||.:.:.  ...|.||...|.
  Fly   137 ITNDISLIKLPVPIEFNKYIQPAKLPVKSDSYSTYGGENAIASGWGKISDSATGATDILQYATVP 201

  Fly   187 IISNSECEQSY-GTVASTDMCTRRTDGKSSCGGDSGGPLVTHDNAR-LVGVITFG-SVDCHSG-P 247
            |::||.|...| |.||::::|.:.|.|.|:|.||||||||..|.:. |:|..:|| ::.|..| |
  Fly   202 IMNNSGCSPWYFGLVAASNICIKTTGGISTCNGDSGGPLVLDDGSNTLIGATSFGIALGCEVGWP 266

  Fly   248 SGYTRVTDYLGWIRDNTGI 266
            ..:||:|.||.||.:.:|:
  Fly   267 GVFTRITYYLDWIEEKSGV 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 90/234 (38%)
Tryp_SPc 40..263 CDD:238113 91/236 (39%)
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 90/234 (38%)
Tryp_SPc 47..282 CDD:238113 91/236 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470903
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.950

Return to query results.
Submit another query.