DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18179 and CG15873

DIOPT Version :9

Sequence 1:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_611910.2 Gene:CG15873 / 37898 FlyBaseID:FBgn0035003 Length:297 Species:Drosophila melanogaster


Alignment Length:262 Identity:66/262 - (25%)
Similarity:110/262 - (41%) Gaps:59/262 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 EGAEGRIVNGY-PAPEGKAPYIVGL----LIRTDGSNSAAVGAGTIIASDWILTAAHCLTTDY-- 91
            |..|..|..|| |.....:.::|.:    .:|..|.|...  :|.:::|..:||||||||..|  
  Fly    30 ETFEMLISGGYKPKSNRLSRHVVSIRTKNYVRHRGDNHFC--SGVLVSSRAVLTAAHCLTDRYKA 92

  Fly    92 ------VEIHYG----------SNWGWNGAFRQSVRRDNFISHPNWPAEGGRDIGLIRTPSVGFT 140
                  :.:.:|          |::       :||  |..:.||.:......|:.::|     .:
  Fly    93 SMNPRGIRVVFGHITRLAVYDESDF-------RSV--DRLVVHPEYERYKKNDLAILR-----LS 143

  Fly   141 DLI---NKVALPSFSEESDR--FVDTWCVACGWGGM-DNGNLADWLQCMDVQIISNSECEQSYGT 199
            :.:   |...||....::..  :.|| |:..|||.: .:|..::.|..:||.:...|.|::.|.|
  Fly   144 ERVQSSNHDVLPLLMRKTANVTYGDT-CITLGWGQIYQHGPYSNELVYLDVILRPPSLCQKHYDT 207

  Fly   200 -VASTDMCTRRTDGKSSCGGDSGGPLVTHDNARLVGVITFGSVDCHSGPSG-----YTRVTDYLG 258
             .|..::||.......:|.||.||||:..      |.: ||.:..|.|.:|     :.....|..
  Fly   208 FTADHNVCTEPVGESMNCAGDMGGPLLCK------GAL-FGLIGGHMGCAGGKAMKFLSFLYYKD 265

  Fly   259 WI 260
            ||
  Fly   266 WI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 62/255 (24%)
Tryp_SPc 40..263 CDD:238113 64/256 (25%)
CG15873NP_611910.2 Tryp_SPc 36..250 CDD:214473 60/237 (25%)
Tryp_SPc 59..250 CDD:238113 55/214 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471190
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.