DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18179 and CG30283

DIOPT Version :9

Sequence 1:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster


Alignment Length:277 Identity:75/277 - (27%)
Similarity:129/277 - (46%) Gaps:36/277 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KLFLLTLSVALAVVAASPGFNRTSLLPQ----VTISEGAEGRIVNGYPAPEGKAPYIVGLLIRTD 62
            |:|::.:.:|.:.|... |....|.|..    |.||   :.:|:.|:.||...||::..::    
  Fly     5 KIFVVVVLLAASSVVVL-GSESGSFLEHPCGTVPIS---QFKILGGHNAPVASAPWMAMVM---- 61

  Fly    63 GSNSAAVGAGTIIASDWILTAAHCLTTDYVEIHYGSNWGWNGAFRQSVRRDNFISHPNWPAEGGR 127
            |......| ||:|.:.::||:|||:....:::..|..  ...|..|....|....|.::..: ..
  Fly    62 GEGGFHCG-GTLITNRFVLTSAHCIANGELKVRLGVL--EREAEAQKFAVDAMFVHTDYYFD-QH 122

  Fly   128 DIGLIR-TPSVGFTDLINKVAL---PSFSEESDRFVD--TWCVACGWGGMDNGNLADWLQCMDVQ 186
            |:.|:| ...|.::|.|:.:.|   |......:..|.  |:    |||..::.:.:..||...:.
  Fly   123 DLALLRLAKRVHYSDNISPICLLLDPLVKNIDEHIVKFRTY----GWGKTESRSSSRMLQKTSLF 183

  Fly   187 IISNSECEQSY--GTVASTDMCTRRTDGKSSCGGDSGGPL---VTHDNARLV---GVITFGSVDC 243
            .:..|||.:.|  ..:....:|....:. ::|.|||||||   ||:|:.::|   ||.:||..||
  Fly   184 NLHRSECAKQYPHQQINRNHICAESANA-NTCNGDSGGPLTAIVTYDHVQMVFQFGVTSFGHADC 247

  Fly   244 HSGPSGYTRVTDYLGWI 260
             |..:.:|.|..:|.||
  Fly   248 -SKATVFTNVMTHLDWI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 63/234 (27%)
Tryp_SPc 40..263 CDD:238113 65/235 (28%)
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 63/234 (27%)
Tryp_SPc 43..266 CDD:238113 65/235 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.