DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18179 and CG10764

DIOPT Version :9

Sequence 1:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster


Alignment Length:248 Identity:69/248 - (27%)
Similarity:108/248 - (43%) Gaps:50/248 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RIVNGYPAPEGKAPYIVGLLIRTDGSNSAAVGAGTIIASDWILTAAHCLTTDYVEIHYGSNWGWN 103
            :|..|..|.|..:.::..:.    .|:....| ||||...::|:|||||..           |::
  Fly    37 KISGGDDAAEPNSIWMAAIF----NSSDFQCG-GTIIHMRFVLSAAHCLVR-----------GYD 85

  Fly   104 GAFRQSVRRDN-----------FISHPNWPAEGGRDIGLIR-TPSVGFTDLINKV------ALPS 150
            ...|...|..|           |:.|....:|...||||:: :.|:.:|..:..:      ||..
  Fly    86 LYVRLGARNINEPAAVHTVINVFVHHDFIASEYRNDIGLLQLSESIVYTVRVQPICIFLDPALKG 150

  Fly   151 FSEESDRFVDTWCVACGWGGMDNGNLADWLQCMDVQIISNSECEQSYG-TVASTDMCTRRTDGKS 214
            ..|:...|     .|.|||.. ||.|:..||.:.:..:..:||::... .:.|..:|....:| .
  Fly   151 SVEKLKTF-----RALGWGNR-NGKLSIMLQTIYLLHLKRNECKRKLNFNLNSRQICAGTKNG-D 208

  Fly   215 SCGGDSGGPLVTH----DNARL---VGVITFGSVDCHSGPSGYTRVTDYLGWI 260
            :|.|||||||.|:    .|...   :|:::||..:|. |...||.||.|:.||
  Fly   209 TCRGDSGGPLSTNILFPSNKSYEVQLGIVSFGDPECR-GVGVYTDVTSYVDWI 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 67/246 (27%)
Tryp_SPc 40..263 CDD:238113 69/247 (28%)
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 67/246 (27%)
Tryp_SPc 38..263 CDD:238113 69/247 (28%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435882
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.