DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18179 and Jon44E

DIOPT Version :9

Sequence 1:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster


Alignment Length:278 Identity:124/278 - (44%)
Similarity:171/278 - (61%) Gaps:17/278 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLFLLTLSVALAVVAASPGFNRTSL----LPQVTISEGAEGRIVNGYPAPEGKAPYIVGLLIRT 61
            ||||:....:|:|.....|..:..::    :|:   :...||||.|||||.|||.||||||.. .
  Fly     1 MKLFVFLACLAVASAGVVPSESARAVPVKDMPR---AGKIEGRITNGYPAYEGKIPYIVGLSF-N 61

  Fly    62 DGSNSAAVGAGTIIASDWILTAAHCL-TTDYVEIHYGSNWGWNGAFRQSVRRDNFISHPNWPAEG 125
            ||....   .|:||...|:||||||. :.::|.|::|:::.....:...|.|.:.|.||:|....
  Fly    62 DGGYWC---GGSIIDHTWVLTAAHCTNSANHVLIYFGASFRHEAQYTHWVSRSDMIQHPDWNDFL 123

  Fly   126 GRDIGLIRTPSVGFTDLINKVALPSFSEESDRFVDTWCVACGWGGMDNGN-LADWLQCMDVQIIS 189
            ..||.|||.|.|.|..|:|||.|||:::..:.:...|.||.|||..||.: ::::|.|:|||||.
  Fly   124 NNDIALIRIPHVDFWSLVNKVELPSYNDRYNSYSGWWAVASGWGLTDNNSGMSNYLNCVDVQIID 188

  Fly   190 NSECEQSYGTVASTD--MCTRRTDGKSSCGGDSGGPLVTHDNARLVGVITFGSVD-CHSG-PSGY 250
            |::|...||:...||  :|.....|||||.||||||||.|||.|:||:::|||.: |.:| |:|:
  Fly   189 NNDCRNYYGSNYITDNTICINTDGGKSSCSGDSGGPLVLHDNNRIVGIVSFGSGEGCTAGRPAGF 253

  Fly   251 TRVTDYLGWIRDNTGISY 268
            ||||.||.||||:|||.|
  Fly   254 TRVTGYLDWIRDHTGIVY 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 106/226 (47%)
Tryp_SPc 40..263 CDD:238113 108/228 (47%)
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 106/226 (47%)
Tryp_SPc 41..266 CDD:238113 108/228 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470771
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.950

Return to query results.
Submit another query.