DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18179 and scaf

DIOPT Version :9

Sequence 1:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster


Alignment Length:230 Identity:52/230 - (22%)
Similarity:84/230 - (36%) Gaps:55/230 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 SNSAAVGAGTIIASDWILTAAHCL----TTDYVEIHYGSNWGWN-GAFRQ-------SVRRDNFI 116
            |:...:..|.||...::|::|.|:    .|| :.:..|.   |. |:..:       .|:..:. 
  Fly   444 SSKTLICGGAIIGDQFVLSSASCVNGLPVTD-IRVKAGE---WELGSTNEPLPFQLTGVKTVDV- 503

  Fly   117 SHPNW-PAEGGRDIGLIRTP-SVGFTDLINKVAL----PSFSEESDRFVDTWCVACGWGGM---- 171
             ||:: |:....|:.:||.. .:.|...|..:.:    |..||:        |...|||..    
  Fly   504 -HPDYDPSTNSHDLAIIRLERRLEFASHIQPICISDEDPKDSEQ--------CFTSGWGKQALSI 559

  Fly   172 -DNGNLADWLQCMDVQIISNSECEQSYGTVAST---DMCTRRTDGKSSCGGDSGGPLVTHDNARL 232
             :.|.|   :...|....:.|||.....:|.|.   |.|........:||..|        :.||
  Fly   560 HEEGAL---MHVTDTLPQARSECSADSSSVCSATKFDSCQFDVGSALACGSGS--------SVRL 613

  Fly   233 VGVITFGSVDCHSGPSGYTRVTDYLGWIRDNTGIS 267
            .|:.. |...|..|.:......| :.||  ||..:
  Fly   614 KGIFA-GENSCGEGQTVRFAKPD-IKWI--NTAFA 644

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 48/221 (22%)
Tryp_SPc 40..263 CDD:238113 50/224 (22%)
scafNP_610180.1 FtsK <198..>334 CDD:332908
Tryp_SPc 428..616 CDD:238113 43/196 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435390
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.