DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18179 and CG17572

DIOPT Version :9

Sequence 1:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_609941.2 Gene:CG17572 / 35182 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster


Alignment Length:262 Identity:65/262 - (24%)
Similarity:107/262 - (40%) Gaps:43/262 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 EGRIVNGYPAPEGKAPYIVGLLIRTDGSNSAAVG-AGTIIASDWILTAAHCLTTD-----YVEIH 95
            :|....|.    |..|::..:..:...:.:.|.. ||.:||...|||||||....     ...:.
  Fly   130 QGHFYKGL----GSYPFVARIGFKHVNTGAFAYPCAGAVIARRVILTAAHCALAKADGHRLSSVR 190

  Fly    96 YG----------SNWGWNGAFRQSVRRDNFISHPNW-PAEGGRDIGL--IRTPSVGFTDLINKVA 147
            .|          :|.|:......:....:.|.||:: ..:...||.|  ::|| :.::.....:.
  Fly   191 VGEYDTSSDPDCANTGFCAPRSVNHAISHVIVHPDYKQGQYHHDIALLVLKTP-LNYSVATQPIC 254

  Fly   148 LPSFSEESDRFVDTWCVACGWGGMDNGNLAD-WLQCMDVQIISNSECEQSYGTVASTD------- 204
            |.  ...::..|.......|||.|...::.. .:..:||.:.|...|.::||:..:.:       
  Fly   255 LQ--KTRANLVVGKRATIAGWGKMSTSSVRQPEMSHLDVPLTSWDLCLRNYGSTGALESPNSIEG 317

  Fly   205 --MCTRRTDGKSSCGGDSGGPLVTHDNA--RLVGVITFGSVDCHSG---PSGYTRVTDYLGWIRD 262
              ||. ..:||..|.|..|.||...:|.  ..:|:::|||.:| .|   ||.||.|..:..||.|
  Fly   318 QWMCA-GGEGKDVCQGFGGAPLFIQENGIFSQIGIMSFGSDNC-GGLRIPSVYTSVAHFSEWIHD 380

  Fly   263 NT 264
            ||
  Fly   381 NT 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 59/254 (23%)
Tryp_SPc 40..263 CDD:238113 61/256 (24%)
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 60/247 (24%)
Tryp_SPc 138..378 CDD:214473 58/244 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.