DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18179 and PRSS38

DIOPT Version :9

Sequence 1:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_898885.1 Gene:PRSS38 / 339501 HGNCID:29625 Length:326 Species:Homo sapiens


Alignment Length:294 Identity:90/294 - (30%)
Similarity:129/294 - (43%) Gaps:45/294 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LFLLTLSVA----LAVVAASPGFNRTSLLPQVTISE-GAEGRIVNGYPAPEGKAPYIVGLLIRTD 62
            |.||.|.||    .|:|...|.....||...|.... ..||:|:.|.||||.|.|:.|.  :...
Human    18 LLLLLLVVAPPRVAALVHRQPENQGISLTGSVACGRPSMEGKILGGVPAPERKWPWQVS--VHYA 80

  Fly    63 GSNSAAVGAGTIIASDWILTAAHCLTTD--------YVEIHYGSNWGWNGAFRQSVRRDNFISHP 119
            |.:   |..|:|:...|:|:||||...|        ||.:   .|....|...|....:..|.||
Human    81 GLH---VCGGSILNEYWVLSAAHCFHRDKNIKIYDMYVGL---VNLRVAGNHTQWYEVNRVILHP 139

  Fly   120 NW----PAEGGRDIGLIRTPS-VGFTDLINKVAL--PSFSEESDRFVDTWCVACGWGGMD-NGNL 176
            .:    |.  |.|:.|::..: :.|::.:..|.|  |..:..|..     |.|.|||.:. .|..
Human   140 TYEMYHPI--GGDVALVQLKTRIVFSESVLPVCLATPEVNLTSAN-----CWATGWGLVSKQGET 197

  Fly   177 ADWLQCMDVQIISNSECEQSYGTVA--STDM-CTRR-TDGKSSCGGDSGGPLVTHDNAR--LVGV 235
            :|.||.|.:.:|....|...||.::  ..|| |... .:.|:.|.||||||||...|..  .:|:
Human   198 SDELQEMQLPLILEPWCHLLYGHMSYIMPDMLCAGDILNAKTVCEGDSGGPLVCEFNRSWLQIGI 262

  Fly   236 ITFGSVDCHSG--PSGYTRVTDYLGWIRDNTGIS 267
            :::|. .|.:.  |..|..|:.:..||.||..|:
Human   263 VSWGR-GCSNPLYPGVYASVSYFSKWICDNIEIT 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 71/244 (29%)
Tryp_SPc 40..263 CDD:238113 73/246 (30%)
PRSS38NP_898885.1 Tryp_SPc 60..291 CDD:238113 73/246 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.