DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18179 and Jon25Bi

DIOPT Version :9

Sequence 1:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster


Alignment Length:280 Identity:136/280 - (48%)
Similarity:178/280 - (63%) Gaps:27/280 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLFLLTLSVALAVVAAS------PGFNRTSLLPQVTISEGAEGRIVNGYPAPEGKAPYIVGLLI 59
            ||:|:: |::|||.|:|.      |     ..||:.|   ...|||||||||.||||||.|||..
  Fly     1 MKVFVV-LALALAAVSAETVQQVHP-----KDLPKDT---KINGRIVNGYPAYEGKAPYTVGLGF 56

  Fly    60 RTDGSNSAAVG---AGTIIASDWILTAAHCLT-TDYVEIHYGSNWGWNGAFRQSVRRDNFISHPN 120
            ..:|      |   .|:|||.||:||||||.. ...|.|:||:.|..|..|..:|...:||.:.|
  Fly    57 SGNG------GWWCGGSIIAHDWVLTAAHCTNGASQVTIYYGATWRTNAQFTHTVGSGDFIQNHN 115

  Fly   121 WPAEGGRDIGLIRTPSVGFTDLINKVALPSFSEESDRFVDTWCVACGWGGMDNGNLADWLQCMDV 185
            ||.:.|.||.|||||.|.|..::|||.||||::..:.:.:.|.||||||....|:..||::|:|:
  Fly   116 WPNQNGNDIALIRTPHVDFWHMVNKVELPSFNDRYNMYDNYWAVACGWGLTTAGSQPDWMECVDL 180

  Fly   186 QIISNSECEQSYGTVASTDMCTRRTDGKSSCGGDSGGPLVTHDNARLVGVITFGSVD-CHSG-PS 248
            ||||||||.::|||.....:|...:.|||:|.||||||||.||..|||||.::.|.: |.:| ||
  Fly   181 QIISNSECSRTYGTQPDGILCVSTSGGKSTCSGDSGGPLVLHDGGRLVGVTSWVSGNGCTAGLPS 245

  Fly   249 GYTRVTDYLGWIRDNTGISY 268
            |:||||:.|.|||||:|::|
  Fly   246 GFTRVTNQLDWIRDNSGVAY 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 115/226 (51%)
Tryp_SPc 40..263 CDD:238113 117/228 (51%)
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 115/226 (51%)
Tryp_SPc 37..260 CDD:238113 117/228 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470711
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.950

Return to query results.
Submit another query.