DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18179 and psh

DIOPT Version :9

Sequence 1:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster


Alignment Length:249 Identity:69/249 - (27%)
Similarity:110/249 - (44%) Gaps:36/249 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 IVNGYPAPEGKAPYIVGLLIRTDGSNSAAVGAGTIIASDWILTAAHCLTTD-----YVEIHYGSN 99
            ||.|||...|..|::..:...|.|::...  .|::|||.::||||||:.||     :|.:...:.
  Fly   144 IVGGYPVDPGVYPHMAAIGYITFGTDFRC--GGSLIASRFVLTAAHCVNTDANTPAFVRLGAVNI 206

  Fly   100 WGWNGAFRQSVRRDNFISHPNWPAEGGRDIGLIRTP-SVGFTDLINKVALPSFSEESDRFVDTWC 163
            ...:.:::..|.|...| ||.:......||.::... .|..||.|....|  .::.:|...::..
  Fly   207 ENPDHSYQDIVIRSVKI-HPQYVGNKYNDIAILELERDVVETDNIRPACL--HTDATDPPSNSKF 268

  Fly   164 VACGWGGMDNGNLA--DWLQCMDVQIISNSECEQSY------------GTVASTDMCTRRTDGK- 213
            ...|||.::....|  ..|....::::...:|..||            |.:.|. :|.  .|.| 
  Fly   269 FVAGWGVLNVTTRARSKILLRAGLELVPLDQCNISYAEQPGSIRLLKQGVIDSL-LCA--IDQKL 330

  Fly   214 --SSCGGDSGGPLVTHDNAR-----LVGVITFGSVDCHSGPSGYTRVTDYLGWI 260
              .:|.|||||||:...|..     ::|||:.|.......|..||||:.||.:|
  Fly   331 IADACKGDSGGPLIHELNVEDGMYTIMGVISSGFGCATVTPGLYTRVSSYLDFI 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 68/247 (28%)
Tryp_SPc 40..263 CDD:238113 69/249 (28%)
pshNP_573297.1 CLIP 30..79 CDD:197829
Tryp_SPc 143..384 CDD:214473 68/247 (28%)
Tryp_SPc 144..387 CDD:238113 69/249 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436989
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.