DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18179 and CG31220

DIOPT Version :9

Sequence 1:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_732440.2 Gene:CG31220 / 326126 FlyBaseID:FBgn0051220 Length:363 Species:Drosophila melanogaster


Alignment Length:290 Identity:69/290 - (23%)
Similarity:107/290 - (36%) Gaps:85/290 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 PQVTISEGAEGRIVNGYPAPEGKAPYIVGLLIRTDGSNSAAVG---------AGTIIASDWILTA 83
            ||.|      .|::.|......:.|::..||.|    |.:|..         .|::|.:.::|||
  Fly    98 PQTT------NRVIGGTEPNLNEYPWLAMLLYR----NRSAFNPDRELVPSCGGSLINTRYVLTA 152

  Fly    84 AHCLTTDYVEIHYGSNWGWNGAFRQSVR-RDNFISH-PNWPAEGGR------------------- 127
            |||:|...::|             |.|| .::..|| |:..:.|.|                   
  Fly   153 AHCVTDTVLQI-------------QRVRLGEHTTSHNPDCISRGARIVCAPTHLDIDVESITSHN 204

  Fly   128 -----------DIGLIRTPS-VGFTDLINKVALPSFSEESDRFVDTWCVACGWG--GM-DNGNLA 177
                       ||.|:|... |.:|.....:.:..:.....:|.   ....|||  || |.|:..
  Fly   205 DYDPANYTFRNDIALVRLKEPVRYTMAYYPICVLDYPRSLMKFK---MYVAGWGKTGMFDTGSKV 266

  Fly   178 DWLQCMDVQIISNSECEQSYG---TVASTDMCTRRTDGKSSCGGDSGGPLVTHDNARLVGVITF- 238
              |:...|::....||.:.|.   ......:|....|.:.:|.||||.||: ..:.|....||| 
  Fly   267 --LKHAAVKVRKPEECSEKYAHRHFGPRFQICAGGLDNRGTCDGDSGSPLM-GTSGRSYETITFL 328

  Fly   239 GSVDCHSGPSG-------YTRVTDYLGWIR 261
            ..:..:.||.|       :||...:..|||
  Fly   329 AGITSYGGPCGTIGWPSVFTRTAKFYKWIR 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 63/276 (23%)
Tryp_SPc 40..263 CDD:238113 65/278 (23%)
CG31220NP_732440.2 Tryp_SPc 103..357 CDD:214473 63/276 (23%)
Tryp_SPc 104..360 CDD:238113 65/278 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435854
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.