DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18179 and ctrb.1

DIOPT Version :9

Sequence 1:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_997783.1 Gene:ctrb.1 / 322451 ZFINID:ZDB-GENE-030131-1171 Length:263 Species:Danio rerio


Alignment Length:273 Identity:92/273 - (33%)
Similarity:130/273 - (47%) Gaps:28/273 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FLLTLSVALAVVAASPGFNRTSLLPQVTISEGAEGRIVNGYPAPEGKAPYIVGLLIRTDGSNSAA 68
            ||..|| .||...|:.|....::.|.||    ...|||||..|.....|:.|.|   .|.:....
Zfish     3 FLWILS-CLAFFGAAYGCGIPAIPPVVT----GYARIVNGEEARPHSWPWQVSL---QDSTGFHF 59

  Fly    69 VGAGTIIASDWILTAAHC-LTTDYVEIHYGSNWGWNGAFRQSVRRDNFISHPNWPA-EGGRDIGL 131
            .| |::|..:|::||||| :.|.:..|....:...|....|::.....|.|||:.: ....||.|
Zfish    60 CG-GSLINENWVVTAAHCNVRTSHRVILGEHDRSSNAEAIQTIAVGKSIKHPNYNSFTINNDILL 123

  Fly   132 IR--TPSVGFTDLINKVALP-SFSEESDRFVDTW-CVACGWGGMDNGNLAD---WLQCMDVQIIS 189
            |:  ||:     .||....| ..:|.:|.|.... ||..|| |:...|..|   .||...:.:::
Zfish   124 IKLATPA-----KINTHVSPVCLAETNDNFPGGMKCVTSGW-GLTRYNAPDTPALLQQAALPLLT 182

  Fly   190 NSECEQSYGTVASTDMCTRRTDGKSSCGGDSGGPLVTHDNA--RLVGVITFGSVDCH-SGPSGYT 251
            |.:|::.:||..:..|......|.|||.||||||||..:|.  .|||::::||..|. |.|:.|.
Zfish   183 NDDCKRYWGTNITDLMICAGASGVSSCMGDSGGPLVCENNRVWTLVGIVSWGSSTCSTSTPAVYA 247

  Fly   252 RVTDYLGWIRDNT 264
            |||....|: |.|
Zfish   248 RVTKLRAWV-DQT 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 78/232 (34%)
Tryp_SPc 40..263 CDD:238113 78/234 (33%)
ctrb.1NP_997783.1 Tryp_SPc 33..256 CDD:214473 78/232 (34%)
Tryp_SPc 34..259 CDD:238113 79/235 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.