DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18179 and spirit

DIOPT Version :9

Sequence 1:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster


Alignment Length:250 Identity:69/250 - (27%)
Similarity:108/250 - (43%) Gaps:49/250 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 IVNGYPAPEGKAPYIVGLLIRTDGSNSAAVG-AGTIIASDWILTAAHC------------LTTDY 91
            :|.|.|....:.|::..|..|::........ .|.:||::::||||||            |..|.
  Fly   132 VVGGMPTRPREFPFMAALGWRSNFDQRIYYRCGGALIANNFVLTAAHCADLGGEPPSQVRLGGDN 196

  Fly    92 VEIHYGSNWGWNGAFRQSVRRDNFISHPNWPAEGG-RDIGLIRTPSVGFTDLINKVALPSFSEES 155
            :.:..|.:        .|:||  .|.||::.|... .||.|:...:....:|     .|:.....
  Fly   197 LTLTEGED--------ISIRR--VIIHPDYSASTAYNDIALLELETAAKPEL-----KPTCIWTQ 246

  Fly   156 DRFVDTWCVACGWG-----GMDNGNLADWLQCMDVQIISNSECEQSYGT------VASTDMCTRR 209
            ....:|...|.|:|     |:.:..|..    :.::.:||.||:..|..      |..|.||...
  Fly   247 KEVTNTLVTAIGYGQTSFAGLSSAQLLK----VPLKSVSNEECQHHYQKDQLAQGVLGTQMCAGD 307

  Fly   210 TDG-KSSCGGDSGGPLVTHDN--ARLVGVITFGSVDCHSG-PSGYTRVTDYLGWI 260
            ..| :.:|.|||||||:..|.  ..:||:.:.|. .|.|| ||.||||:.::.||
  Fly   308 ITGERDTCQGDSGGPLLMQDGLLGYVVGITSLGQ-GCASGPPSVYTRVSSFVDWI 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 67/248 (27%)
Tryp_SPc 40..263 CDD:238113 68/249 (27%)
spiritNP_001162707.1 CLIP 51..98 CDD:197829
Tryp_SPc 132..364 CDD:238113 68/249 (27%)
Tryp_SPc 132..361 CDD:214473 67/248 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436987
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.