DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18179 and CG11664

DIOPT Version :9

Sequence 1:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster


Alignment Length:199 Identity:45/199 - (22%)
Similarity:82/199 - (41%) Gaps:35/199 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 GYPAPEGKAPYIVGLLIRTDGSNSAAVGAGTIIASDWILTAAHCL----TTDYVEIHYGSNW-GW 102
            |.|..:....|::.:.      ....:.||::.::.::||.|||.    ..:.:.:..|..| .|
  Fly    26 GIPVQQQNYGYVMQIY------GPQFLAAGSLFSARYVLTVAHCFKKNTKPEELSVRAGYRWIAW 84

  Fly   103 NGAFRQSVRRDNFISHPNW-PAEGGRDIGLIRT-PSVGFTDLINKVALPS--------FSEESDR 157
            ....:|..   ..:.||.: |.....||.::|. .::..:.:||.:.|.|        |:...: 
  Fly    85 EFRGKQVA---GLLRHPKFSPLTLRNDIAVLRVKAAISHSHMINYIGLCSRPLTPLNMFAPPQE- 145

  Fly   158 FVDTWCVACGWGGMDNGNLADWLQCMDVQIISNSECEQSYGTVASTDMCTRRTDGKSSCGGDSGG 222
                   ..||..|   ::|..|:.|.||:.....|.|.:..::...:|...|.|:..|.||||.
  Fly   146 -------LAGWNLM---HIAQPLKSMSVQVEPEKNCRQWFPQISGGVICASATMGEGLCYGDSGD 200

  Fly   223 PLVT 226
            ||::
  Fly   201 PLIS 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 45/199 (23%)
Tryp_SPc 40..263 CDD:238113 45/199 (23%)
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 42/187 (22%)
Tryp_SPc 38..237 CDD:214473 42/187 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.