DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18179 and Mcpt2

DIOPT Version :9

Sequence 1:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_742041.1 Gene:Mcpt2 / 29266 RGDID:621058 Length:247 Species:Rattus norvegicus


Alignment Length:268 Identity:71/268 - (26%)
Similarity:115/268 - (42%) Gaps:43/268 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LFLLTLSVALAVVAASPGFNRTSLLPQVTISEGAEGRIVNGYPAPEGKAPYIVGLLIRTDGSNSA 67
            |||:.|                 |||.   ..||| .|:.|..:.....||:..|.|.|:.....
  Rat     5 LFLMAL-----------------LLPS---GAGAE-EIIGGVESIPHSRPYMAHLDIVTEKGLRV 48

  Fly    68 AVGAGTIIASDWILTAAHCLTTDYVEIHYGSNWGWNGAFRQSVRRDNFISHPNWPAEGG-RDIGL 131
            ..| |.:|:..::||||||...:...|....:.....:.:|.::.:..|.|.::.:... .||.|
  Rat    49 ICG-GFLISRQFVLTAAHCKGREITVILGAHDVRKRESTQQKIKVEKQIIHESYNSVPNLHDIML 112

  Fly   132 IR-TPSVGFTDLINKVALPSFSEESDRFV--DTWCVACGWGGMDNGNLADW-LQCMDVQIISNSE 192
            :: ...|..|..:|.|.|||.|:    |:  ...|.|.|||.....:...: |:.::::|:....
  Rat   113 LKLEKKVELTPAVNVVPLPSPSD----FIHPGAMCWAAGWGKTGVRDPTSYTLREVELRIMDEKA 173

  Fly   193 CEQSYGTVASTDMCT-RRTDGKSSCGGDSGGPL----VTHDNARLVGVITFGSVDCHSGPSGYTR 252
            |...........:|. ..|..:::..|||||||    |.|      |::::|..|. ..|:.:||
  Rat   174 CVDYRYYEYKFQVCVGSPTTLRAAFMGDSGGPLLCAGVAH------GIVSYGHPDA-KPPAIFTR 231

  Fly   253 VTDYLGWI 260
            |:.|:.||
  Rat   232 VSTYVPWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 59/230 (26%)
Tryp_SPc 40..263 CDD:238113 61/231 (26%)
Mcpt2NP_742041.1 Tryp_SPc 20..239 CDD:214473 59/230 (26%)
Tryp_SPc 21..242 CDD:238113 61/231 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.