DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18179 and CG33462

DIOPT Version :9

Sequence 1:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster


Alignment Length:219 Identity:50/219 - (22%)
Similarity:83/219 - (37%) Gaps:38/219 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 AGTIIASDWILTAAHCLTTD-YVEIHYGSNWGWNGAFRQSVRRDNFI--------------SHPN 120
            :||:|...::||||||:..| .:.:..|.   :|  .:..|..||.:              .|..
  Fly    62 SGTLINHLFVLTAAHCVPDDLLITVRLGE---YN--TKTKVDCDNHLCQEPFQEYNVDMGFRHRY 121

  Fly   121 WPA-EGGRDIGLIRT-PSVGFTDLINKV---ALPSFSEESDRFVDTWCVACGWGGMDNGNLADWL 180
            :.| :...|||::|. ..|.:.:.|..:   |...|.|..|:.  ||.....|........:..|
  Fly   122 YNANDQTNDIGMLRLGRRVEYLNHIRPICIFASNRFQEPIDQL--TWFTTTVWRETAANATSKVL 184

  Fly   181 QCMDVQIISNSECEQSYG-TVASTDMCTRRTDGKSSCGGDSGGPLVT------HDNARLVGVITF 238
            :.|::.......|.:.|| .:....:|...|..: .|..|||.|.:.      .|....:|:.:.
  Fly   185 RTMNIDRQPKETCSEIYGWNMTFEQICAGNTLSQ-LCSTDSGAPQIRKMWHNGSDRYVQLGIASR 248

  Fly   239 GSVDCHSGPSGYTR-VTDYLGWIR 261
            ....|.:  ||... :..|..||:
  Fly   249 VKGQCQN--SGILMDLLSYADWIK 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 48/216 (22%)
Tryp_SPc 40..263 CDD:238113 50/219 (23%)
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 50/219 (23%)
Tryp_SPc 48..269 CDD:214473 48/216 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435877
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.