DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18179 and CG33461

DIOPT Version :9

Sequence 1:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster


Alignment Length:301 Identity:78/301 - (25%)
Similarity:123/301 - (40%) Gaps:67/301 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLFLLTLSV-ALAVVAASPGF--NRTSLLPQVTISEGAEGRIVNGYPAPEGKAPYIVGLLIRTD 62
            ||..:..|:: .|.|..:|..|  ....::|:::.      :|:||.||..|:.|::..|...| 
  Fly     6 MKTIIAYLALFVLGVHGSSSVFLEENCGVVPRLSY------KIINGTPARLGRYPWMAFLHTPT- 63

  Fly    63 GSNSAAVGAGTIIASDWILTAAHCLTTDYVEI--HYGSNWGWNGAFRQSVRRDNFISHPN----- 120
                ..:.||::|...::||:|||:..| ||:  ..|.|           .|||.|...|     
  Fly    64 ----YFLCAGSLINQWFVLTSAHCIEDD-VELIARLGEN-----------NRDNDIDCENNRCLE 112

  Fly   121 ----------------WPAEGGRDIGLIRTP-SVGFTDLINKVALPSFSEESDRFV---DTWCVA 165
                            .|.:...|||::|.. .|.:|..|..:.:  |.....:.|   .||..|
  Fly   113 ATQEYNVDMLFKHRLYDPKDFSNDIGMLRLERRVEYTYHIQPICI--FHHRRMQLVVDQITWFKA 175

  Fly   166 CGWG--GMD-NGNLADWLQCMDVQIISNSECEQSY-GTVASTDMCTRRTDGKSSCGGDSGGP--- 223
            .|||  ..| |...:..|..:::.....::|.:.: ....|..:|....|| :.|.||||||   
  Fly   176 TGWGLTSTDLNTKSSRVLMELNLYRRPRNDCARIFKQNFLSGQICAGNDDG-NLCRGDSGGPQGR 239

  Fly   224 -LVTHDNARLV--GVITFGSVDCHSGPSGYTRVTDYLGWIR 261
             ::.....|.|  |:.:|...:| |..|..|.|..|..||:
  Fly   240 YVLIFGMKRFVQMGIASFTYENC-SKVSILTDVVRYGRWIK 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 68/257 (26%)
Tryp_SPc 40..263 CDD:238113 70/259 (27%)
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 68/257 (26%)
Tryp_SPc 42..281 CDD:238113 70/259 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435878
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.