DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18179 and Sp212

DIOPT Version :9

Sequence 1:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster


Alignment Length:284 Identity:78/284 - (27%)
Similarity:128/284 - (45%) Gaps:44/284 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 AVVAASPG------FNRTSLLPQVTISEGAEGR----IVNGYPAPEGKAPYIVGLLIRTDGSNSA 67
            |||...|.      |:..|.:..|..  |.||.    ||.|...|.|:.|:: ..:...:....|
  Fly   242 AVVTVPPATPPPQRFDPRSQISSVVC--GREGSTTPFIVRGNEFPRGQYPWL-SAVYHKEVRALA 303

  Fly    68 AVGAGTIIASDWILTAAHC---LTTDYVEIHYG----SNWGWNGAFRQSVRRDNFISHP--NWPA 123
            ....|::|:|..:::||||   :|.|.|.:..|    .::|.:||..::|.|  .:.||  |..:
  Fly   304 FKCRGSLISSSIVISAAHCVHRMTEDRVVVGLGRYDLDDYGEDGAEMRNVMR--LLWHPDYNTRS 366

  Fly   124 EGGRDIGLIRTP-SVGFTDLINKVALPSFSEESDRFVDTWCVACGWGGMDNGNLADWLQCMDVQI 187
            ....||.||... .|.|.|:|..:.:  ::.|:.|.|.|.....|||..::.:...:.:.::.:|
  Fly   367 YSDADIALITIERPVTFNDIIAPICM--WTVEASRTVSTTGFIAGWGRDEDSSRTQYPRVVEAEI 429

  Fly   188 ISNSECEQSY-GT-VASTDMCTRRTDGKSSCGGDSGGPLVTHDNAR--LVGVITFGSVDCHSGPS 248
            .|.:.|..:: || |....:|....||...|.|||||.|:.....|  |.|:::.|    ..||:
  Fly   430 ASPTVCASTWRGTMVTERSLCAGNRDGSGPCVGDSGGGLMVKQGDRWLLRGIVSAG----ERGPA 490

  Fly   249 G---------YTRVTDYLGWIRDN 263
            |         |..::.::.||.:|
  Fly   491 GTCQLNQYVLYCDLSKHINWISEN 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 65/247 (26%)
Tryp_SPc 40..263 CDD:238113 67/245 (27%)
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 67/245 (27%)
Tryp_SPc 277..511 CDD:214473 65/242 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436793
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.