DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18179 and PRSS33

DIOPT Version :9

Sequence 1:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001372391.1 Gene:PRSS33 / 260429 HGNCID:30405 Length:280 Species:Homo sapiens


Alignment Length:287 Identity:82/287 - (28%)
Similarity:119/287 - (41%) Gaps:51/287 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LSVALAVVAASPGF--NRTSLLPQVTISEGAEGRIVNGYPAPEGKAPYIVGLLIRTDGSNSAAVG 70
            |.|.|.:|..:.|.  .:::...|..:|    .|||.|....:|:.|:...:..|     .|.|.
Human     7 LQVLLLLVLGAAGTQGRKSAACGQPRMS----SRIVGGRDGRDGEWPWQASIQHR-----GAHVC 62

  Fly    71 AGTIIASDWILTAAHCLTTDYVEIHYGSNWGWNGAFRQS----------VRRDNFISHPNWPAEG 125
            .|::||..|:||||||.....:...|....   ||.|..          |||  .:..|::..:|
Human    63 GGSLIAPQWVLTAAHCFPRRALPAEYRVRL---GALRLGSTSPRTLSVPVRR--VLLPPDYSEDG 122

  Fly   126 GR-DIGL--IRTPSVGFTDLINKVALPSFSEESDRFVDTWCVACGWGGMDNG-NLADW--LQCMD 184
            .| |:.|  :|.| |..:..:..|.||.......  ..|.|...|||.:..| .|.:|  ||.:.
Human   123 ARGDLALLQLRRP-VPLSARVQPVCLPVPGARPP--PGTPCRVTGWGSLRPGVPLPEWRPLQGVR 184

  Fly   185 VQIISNSECEQSYGTVAST----------DMCTRRTDG-KSSCGGDSGGPLVTHDNAR--LVGVI 236
            |.::.:..|:..|...|..          .:|.....| |.:|.|||||||....:..  ||||:
Human   185 VPLLDSRTCDGLYHVGADVPQAERIVLPGSLCAGYPQGHKDACQGDSGGPLTCLQSGSWVLVGVV 249

  Fly   237 TFGSVDC--HSGPSGYTRVTDYLGWIR 261
            ::|. .|  .:.|..||.|..|..||:
Human   250 SWGK-GCALPNRPGVYTSVATYSPWIQ 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 73/251 (29%)
Tryp_SPc 40..263 CDD:238113 74/253 (29%)
PRSS33NP_001372391.1 Tryp_SPc 37..275 CDD:238113 73/251 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.