DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18179 and CG30187

DIOPT Version :9

Sequence 1:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001246475.2 Gene:CG30187 / 246509 FlyBaseID:FBgn0050187 Length:500 Species:Drosophila melanogaster


Alignment Length:242 Identity:61/242 - (25%)
Similarity:100/242 - (41%) Gaps:45/242 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 VGLLIRTDGSNSAA----------------VGAGTIIASDWILTAAHCLT-TDYVEIHYGSNWGW 102
            :.:.::..|.::||                :..||:|...::||||||:. .|...:..      
  Fly    30 INIALKITGGHNAAFQNSVWMAAVHNRTHFICGGTLIHKRFVLTAAHCIVDQDVQSVSL------ 88

  Fly   103 NGAFRQS---VRRD--NFISHPNWPAEGG--RDIGLIRTPS-VGFTDLINKVALPSFSEESD--R 157
             ||:.:|   .|:|  ..:.|.::.....  .||||::..| |.|..||..:.:......::  |
  Fly    89 -GAYNKSDPADRKDVITAVVHSSFDVRASYENDIGLLKLSSDVIFNALIRPICIVLNKSMANHMR 152

  Fly   158 FVDTWCVACGWGGMDNGNLADWLQCMDVQIISNSECEQSYGTVASTDMCTRRTDGKSSCGGDSGG 222
            .:.|: .|.|||.:.....:|.||.:.:..:...||........|............:|||||||
  Fly   153 NMRTF-KAFGWGTLRGNKTSDILQTIILNHLDREECYMELSVYPSEKQICAGVPSGDTCGGDSGG 216

  Fly   223 PLVTHD-------NARL-VGVITFGSVDCHSGPSGYTRVTDYLGWIR 261
            || |:|       |..: .|:|:.|...| .|...||.:..:..||:
  Fly   217 PL-TNDVFIQGIGNREVQFGIISVGKTSC-DGQGVYTDLMSFADWIK 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 59/239 (25%)
Tryp_SPc 40..263 CDD:238113 61/242 (25%)
CG30187NP_001246475.2 Tryp_SPc 35..260 CDD:214473 59/234 (25%)
Trypsin 316..>384 CDD:355628
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.