DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18179 and CG30088

DIOPT Version :9

Sequence 1:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster


Alignment Length:304 Identity:81/304 - (26%)
Similarity:122/304 - (40%) Gaps:74/304 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLFLLTLSVALAV---------VAASPGFNRTSLLPQ--VTISEGAEGRIVNGYPAPEGKAPYI 54
            |.:.|.:.|:.:.:         |||:      .|:|.  |:.......|||.|..|....||::
  Fly     1 MSISLASTSIYICMCVCLVLQEQVAAN------FLIPSCGVSYESNVATRIVRGKEAMLKSAPFM 59

  Fly    55 VGLLIRTDGSNSAAVGAGTIIASDWILTAAHCLTTDYVEIHYGS-----NWGWNGA--------- 105
            ..|..    |:....| ||||:|.:|||||||: ..|:::..|.     |....|.         
  Fly    60 AYLYY----SSEIHCG-GTIISSRYILTAAHCM-RPYLKVRLGEHDITRNPDCQGGSCSPPAEEF 118

  Fly   106 ----FRQSVRRDNFISHPNWPAEGGRDIGLIR-TPSVGFTD-------LINKVALPSFSEESDRF 158
                ..:..|.|.|:::         ||.|:: :.::.|..       ::|..|.|:..|..   
  Fly   119 DIVLATKYKRFDRFLAN---------DIALLKLSRNIRFNVHIQPICLILNPAAAPNVHEFQ--- 171

  Fly   159 VDTWCVACGWGGMDNGNLADWLQCMDVQIISNSECEQSYGTVASTDMCTRRTDGKSSCGGDSGGP 223
                  |.|||..:..:.|:.||...:....|..|........:.:.......|..:|.||||||
  Fly   172 ------AFGWGQTETNHSANVLQTTVLTRYDNRHCRSVLSMPITINQLCVGFQGSDTCSGDSGGP 230

  Fly   224 LVTHDNARLV------GVITFGSVDCHSGPSGYTRVTDYLGWIR 261
            |||..|...|      |:::||...|.| |..||.|.:|:.|||
  Fly   231 LVTKVNYDGVWRYLQLGIVSFGDDKCQS-PGVYTYVPNYIRWIR 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 69/252 (27%)
Tryp_SPc 40..263 CDD:238113 71/254 (28%)
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 69/252 (27%)
Tryp_SPc 45..273 CDD:238113 69/252 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435874
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.