DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18179 and CG30083

DIOPT Version :9

Sequence 1:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster


Alignment Length:276 Identity:75/276 - (27%)
Similarity:125/276 - (45%) Gaps:39/276 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LFLLTLSVALAVVAASPGFNRTSLLPQVTISEGAEGRIVNGYPAPEGKAPYIVGLLIRTDGSNSA 67
            :|:.|:   ..::...||.....|.|.....: ...:|::|..|..|..|::..:....|...:.
  Fly     1 MFIFTI---FKIILLWPGAMSQFLEPNCGYPD-ISPKIMHGQNAENGTNPWMAYIFKYNDKEVAE 61

  Fly    68 AVGAGTIIASDWILTAAHCLTTDYVEI-----HYGSNWGWNGAFRQSVRRDNFI--SHPNWPAEG 125
            .|..||:|...::|:||||:..|.:..     |..|.:   .|..::.|...|.  |:.|     
  Fly    62 LVCGGTLIHKQFVLSAAHCIKRDQILAVRLGEHSSSRY---FAVTKAFRNKYFTTGSYSN----- 118

  Fly   126 GRDIGLIR-TPSVGFTDLINKVAL---PSFSEESDRFVDTWCVACGWGGMDNGNLADWLQCMDVQ 186
              |||::| .|.|.|..:|..:.:   |:.......|     .|.|||..:|...:..|:.:::.
  Fly   119 --DIGILRIQPIVKFNAVIRPICIITDPTKVPNVKTF-----KAAGWGKTENETFSKVLKTVELN 176

  Fly   187 IISNSEC-EQSYGTVASTDMCTRRTDGKSSCGGDSGGPLV----THDNARLV--GVITFGSVDCH 244
            .::.||| ...:..|..:.:|....|| .:|.|||||||:    ...:.|.|  |:|:|||..|:
  Fly   177 ELNASECYNMLWVNVTESQICAGHPDG-DTCAGDSGGPLIHPVYMDGSLRYVQLGIISFGSSLCN 240

  Fly   245 SGPSGYTRVTDYLGWI 260
            | |..|||::.::.||
  Fly   241 S-PGVYTRLSSFIDWI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 67/238 (28%)
Tryp_SPc 40..263 CDD:238113 69/239 (29%)
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 67/238 (28%)
Tryp_SPc 34..255 CDD:238113 67/237 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435866
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.