DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18179 and Prss8

DIOPT Version :9

Sequence 1:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_620191.1 Gene:Prss8 / 192107 RGDID:619973 Length:342 Species:Rattus norvegicus


Alignment Length:272 Identity:71/272 - (26%)
Similarity:113/272 - (41%) Gaps:65/272 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 GAEG-----------RIVNGYPAPEGKAPYIVGLLIRTDGSNSAAVGAGTIIASDWILTAAHCLT 88
            ||:|           ||..|..|..|:.|:.|.:..     |...|..|:::::.|:::||||..
  Rat    29 GADGTEASCGAVIQPRITGGGSAKPGQWPWQVSITY-----NGVHVCGGSLVSNQWVVSAAHCFP 88

  Fly    89 TDYVEIHYGSNWGWNGAFRQSVRRDNF------------ISHPNWPAEGGR-DIGLIRTPS-VGF 139
            .::.:..|....|       :.:.|:|            |||.::..||.: ||.|||..| |.|
  Rat    89 REHSKEEYEVKLG-------AHQLDSFSNDIVVHTVAQIISHSSYREEGSQGDIALIRLSSPVTF 146

  Fly   140 TDLINKVALPSFSEESDRFVDTWCVACGWGGMDNGNLADW--------LQCMDVQIISNSECEQS 196
            :..|..:.||:.:......:.  |...||     |::|..        ||.::|.:||...|...
  Rat   147 SRYIRPICLPAANASFPNGLH--CTVTGW-----GHVAPSVSLQTPRPLQQLEVPLISRETCSCL 204

  Fly   197 YG---------TVASTDMCTRRT-DGKSSCGGDSGGPLVTHDNA--RLVGVITFG-SVDCHSGPS 248
            |.         |:....:|.... .||.:|.|||||||....:.  .|.|::::| :....:.|.
  Rat   205 YNINAVPEEPHTIQQDMLCAGYVKGGKDACQGDSGGPLSCPIDGLWYLAGIVSWGDACGAPNRPG 269

  Fly   249 GYTRVTDYLGWI 260
            .||..:.|..||
  Rat   270 VYTLTSTYASWI 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 66/255 (26%)
Tryp_SPc 40..263 CDD:238113 67/256 (26%)
Prss8NP_620191.1 Tryp_SPc 44..281 CDD:214473 66/255 (26%)
Tryp_SPc 45..284 CDD:238113 67/256 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.