DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18179 and try-5

DIOPT Version :9

Sequence 1:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_505421.3 Gene:try-5 / 187088 WormBaseID:WBGene00006623 Length:327 Species:Caenorhabditis elegans


Alignment Length:262 Identity:61/262 - (23%)
Similarity:102/262 - (38%) Gaps:80/262 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 PEGKAPYIVGLLIRTDGSNSAAVGAGTIIASDWILTAAHCLTTDYVEIHYGSNW------GWNGA 105
            |...||:.|.:.::....:...:..||:|....:||||||.     :.|:|:..      ..:|.
 Worm    50 PTHLAPWAVQIRVKARKGDFEVICGGTLITLKHVLTAAHCF-----QKHFGAKKEGGEENSMSGR 109

  Fly   106 FRQSVRR---------------------------------------------DNFISHPNWPAEG 125
            :.:|.:|                                             |.:.:|    .|.
 Worm   110 YCESNQRFTDSEILTRTVVTVGAMCTRLEQKYGCVNEKQNGKTLKISRFAIGDFYKTH----CEQ 170

  Fly   126 GRDIGLIRTPS-VGFTDLINKVALPSFSE---ESDRFVDTWCVACGWG-----GMDNGNLADWLQ 181
            |.||.::...| :...:..|...||...|   :|...|.::    |||     |.||... ..:|
 Worm   171 GNDIVILELESTIDDVEGANYACLPFLPEVNIQSGANVTSF----GWGSDPGKGFDNAAF-PMIQ 230

  Fly   182 CMDVQIISNSECEQSYGTVASTD-MCTRRTDGKSSCGGDSGGPLVTH--DNAR--LVGVITFGSV 241
            .:.:...:.:.||:::||....| .||...:.|:.|.|||||.|..|  |:||  ::.::::|| 
 Worm   231 VLTLATETLATCEENWGTSIPFDSFCTAEEEDKNVCSGDSGGGLTFHQSDSAREFIIAIVSYGS- 294

  Fly   242 DC 243
            ||
 Worm   295 DC 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 61/262 (23%)
Tryp_SPc 40..263 CDD:238113 61/262 (23%)
try-5NP_505421.3 Tryp_SPc 48..296 CDD:389826 59/260 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.