DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18179 and try-4

DIOPT Version :9

Sequence 1:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_508030.4 Gene:try-4 / 185148 WormBaseID:WBGene00006622 Length:324 Species:Caenorhabditis elegans


Alignment Length:280 Identity:60/280 - (21%)
Similarity:105/280 - (37%) Gaps:77/280 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 PYIVGLLIRTDGSNSAAVGAGTIIASDWILTAAH-CLTTDYVEIHYGSNWGW---NGAFRQSVR- 111
            |:.|...:  ||.|..   .|:||:...|:|||| .:||.....:...|..|   |.:..:|:: 
 Worm    59 PWAVSFTV--DGVNRL---GGSIISPYHIITAAHGFITTIGSRGNLCENKNWKKPNSSIYRSIKF 118

  Fly   112 --------------RDNFISHPNWP----------------AEG---------GRDIGLIRTPS- 136
                          |.:...:||.|                .:|         |.|..::.... 
 Worm   119 LRDTRKVAYGGTCIRGHTDKYPNDPRCKKSDVIHNKVRAVLVDGEFASSNCLKGHDWAIVEVEKR 183

  Fly   137 VGFTDLINKVALPSFSEESDRFVDTWCVACGWGGM----DNGNLADWLQCMDVQIISNSECEQSY 197
            :.|::.:..:.||    ..:.:........|||..    ::|.|..     ::.:..:.:|::.:
 Worm   184 IHFSENVRPICLP----RPNMYYTKSLAVPGWGRSYIFNESGPLIH-----EIPMRIDRDCKRPW 239

  Fly   198 GT---------VASTDMCTRRTDGKSSCGGDSGGPLVTHDN----ARLVGVITFGSVDCHSGP-S 248
            ..         :.:|.|.........:|.|||||.|...|:    |.|:.:.:||:..|.|.. :
 Worm   240 SDRLPADADDFICATSMNVSNYSAPRTCHGDSGGGLEYRDDNYGRAFLIAITSFGTRGCPSNMLA 304

  Fly   249 GYTRVTDYLGWIRDNTGISY 268
            .:|||..||..|.:.||:.|
 Worm   305 RFTRVDMYLNLICNYTGVCY 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 56/270 (21%)
Tryp_SPc 40..263 CDD:238113 57/273 (21%)
try-4NP_508030.4 Tryp_SPc 51..318 CDD:238113 57/272 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.