DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18179 and CG43742

DIOPT Version :9

Sequence 1:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001261130.1 Gene:CG43742 / 14462622 FlyBaseID:FBgn0263999 Length:474 Species:Drosophila melanogaster


Alignment Length:244 Identity:75/244 - (30%)
Similarity:108/244 - (44%) Gaps:46/244 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RIVNGYPAPEGKAPYIVGLLIRTDGSNSAAVGAGTIIASDWILTAAHCL-TTDYVEIHYGSNWGW 102
            |:.||:.|       |....:....:||.....|::|...::||||||: ..|.|.:|.|.|   
  Fly    34 RVANGHTA-------ITSQFMAALYNNSEFFCGGSLIHKQYVLTAAHCVRDLDEVTVHLGEN--- 88

  Fly   103 NGA----FRQSVRRDN--FISHPNWPAEGG---RDIGLIRTP-SVGFTDLINKVAL----PSFSE 153
            |.:    ..:.|.|.|  .|.|||:  .|.   .||.|:|.. .|.|...|..:.:    ...|.
  Fly    89 NRSCPIPVCKHVLRLNAKVILHPNF--HGNIFLNDIALLRLEREVIFEAHIRPICIILDEDVTSN 151

  Fly   154 ESDRFVDTWCVACGWGGMDNGNLADWLQCMDVQIISNSECEQSYGTVASTDMCTRRTDGKSSCGG 218
            ..:.|     .|.|||..::||::|.|..:|:..:..|.|.|:..|:     |...|.| .:|..
  Fly   152 NQNNF-----TAYGWGKTEHGNISDVLSFIDLVRLPKSMCYQNINTI-----CAGSTSG-DTCES 205

  Fly   219 DSGGPLVTHDNAR------LVGVITFGSVDCHSGPSG-YTRVTDYLGWI 260
            ||||||:.:...|      |.|:.::|..:| ||..| ||.|..|..||
  Fly   206 DSGGPLIGNFVHRGKSRDILFGITSYGDAEC-SGLFGVYTDVNAYKSWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 73/242 (30%)
Tryp_SPc 40..263 CDD:238113 74/243 (30%)
CG43742NP_001261130.1 Tryp_SPc 34..253 CDD:214473 73/242 (30%)
Tryp_SPc 35..256 CDD:238113 74/243 (30%)
Tryp_SPc 273..467 CDD:214473
Tryp_SPc 273..>368 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435880
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.