DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18179 and CLIPD3

DIOPT Version :9

Sequence 1:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster
Sequence 2:XP_321698.4 Gene:CLIPD3 / 1281744 VectorBaseID:AGAP001433 Length:670 Species:Anopheles gambiae


Alignment Length:321 Identity:85/321 - (26%)
Similarity:128/321 - (39%) Gaps:75/321 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SVALAVVAASPGFNRTS--------LLPQVTISEGAE---------------------------- 37
            |:.|:.|...|....|:        |:|..|:|.|.|                            
Mosquito   358 SLVLSPVVKPPATTTTTTTTTTKRPLVPVYTVSPGEEGSALLSATLKPIDNIVDPDDCGQQEYSS 422

  Fly    38 GRIVNGYPAPEGKAPYIVGLLIRTDGSNSAAVGAGTIIASDWILTAAHCLTTDYVEIHYGSNWGW 102
            ||||.|..||.|:.|::..:.:..........| |::|.:.:||||||| |.|..:..:      
Mosquito   423 GRIVGGIEAPTGQWPWMAAIFLHGTKRTEFWCG-GSLIGTKYILTAAHC-TRDSRQRPF------ 479

  Fly   103 NGAFRQSVRRDNFI--------------------SHPNWPAEG-GRDIG-LIRTPSVGFTDLINK 145
              |.||...|...|                    :||.:...| ..||. |:....|..:..:..
Mosquito   480 --AARQFTVRLGDIDLSTDGEPSAPVTYKVTEVRAHPRFSRVGFYNDIALLVLDKPVRKSKYVIP 542

  Fly   146 VALPSFSEES-DRFVDTWCVACGWG-GMDNGNLADWLQCMDVQIISNSECEQSY-GTVASTDMCT 207
            |.||..:..| :|.........||| ....|..:...|...:.:..|.:|.::| ..:....:|.
Mosquito   543 VCLPGPNLPSKERLAGRRATVVGWGTTYYGGKESTKQQQATLPVWRNEDCNRAYFQPITDNFVCA 607

  Fly   208 RRTD-GKSSCGGDSGGPLVTHDNAR--LVGVITFGSVDCHSG-PSGYTRVTDYLGWIRDNT 264
            ..:: |..:|.|||||||:....||  .|||::||:.....| |..|||:::|:.|||:||
Mosquito   608 GFSEGGVDACQGDSGGPLMMLVEARWTQVGVVSFGNKCGEPGYPGVYTRISEYMEWIRENT 668

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 68/249 (27%)
Tryp_SPc 40..263 CDD:238113 70/251 (28%)
CLIPD3XP_321698.4 CLIP 292..335 CDD:197829
Tryp_SPc 424..664 CDD:214473 68/249 (27%)
Tryp_SPc 425..667 CDD:238113 70/251 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.