DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18179 and CG43336

DIOPT Version :9

Sequence 1:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001247122.1 Gene:CG43336 / 12798414 FlyBaseID:FBgn0263041 Length:279 Species:Drosophila melanogaster


Alignment Length:291 Identity:68/291 - (23%)
Similarity:116/291 - (39%) Gaps:58/291 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLFLLT-------LSVALAVVAASPGFNRTSLLPQVTISEGAEGRIVNGYPAPEGKAPYIVGLL 58
            :..|||.       |.:|..:.|.||.      :|          |:.||..|....:|: :..|
  Fly     8 LTFFLLPLLGSTQFLDMACGIRAHSPS------VP----------RVKNGTVASLTSSPW-MAFL 55

  Fly    59 IRTDGSNSAAVGAGTIIASDWILTAAHCLTT---------DYVEIHYGSNWGWNGAFRQSVRRDN 114
            ..|||   ..:..|::|.:..:||||||...         :|....|.........:|.....:.
  Fly    56 HSTDG---RFICGGSLITNRLVLTAAHCFLDRTELVARLGEYDREEYEMCHDSYCTYRIEAMVER 117

  Fly   115 FISHPNW-PAEGGRDIGLIRT-PSVGFTDLINKVAL---PSFSEESDRFVDTW--CVACGWGGMD 172
            ...|.:: |.....||.::|. ..|.:||.|..:.:   |.:.    :::|:.  ....|||..:
  Fly   118 GFRHRHYNPMTMAYDIAILRLYRKVQYTDNIRPICIVIDPRWR----KYIDSLDPLTGTGWGKTE 178

  Fly   173 NGNLADWLQCMDVQIISNSECEQSYGTVAST--DMCTRRTDGKSSCGGDSGGP---LVTHDNAR- 231
            :...:..|:.:|:.......|.: |.|::.|  ..|. ..:..:.|.||||||   |:.:..:: 
  Fly   179 SEGDSAKLRTVDLARKHPEVCRR-YATLSLTANQFCA-GNERSNLCNGDSGGPVGALIPYGKSKR 241

  Fly   232 --LVGVITFGSVDCHSGPSGYTRVTDYLGWI 260
              .||:.:|.:..|.. .|.:|.|..|:.||
  Fly   242 FVQVGIASFTNTQCVM-VSVFTDVMSYVDWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 57/244 (23%)
Tryp_SPc 40..263 CDD:238113 58/245 (24%)
CG43336NP_001247122.1 Tryp_SPc 37..271 CDD:214473 57/244 (23%)
Tryp_SPc 40..271 CDD:238113 56/241 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435871
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.