DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18179 and CG43335

DIOPT Version :9

Sequence 1:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001247121.1 Gene:CG43335 / 12798413 FlyBaseID:FBgn0263040 Length:281 Species:Drosophila melanogaster


Alignment Length:271 Identity:72/271 - (26%)
Similarity:118/271 - (43%) Gaps:54/271 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VAASPGFNRTSLLPQVTISEGAEGRIVNGYPAPEGKAPYIVGLLIRTDGSNSAAVGAGTIIASDW 79
            :...|.|:||              ||:.|..|.....|::..|.     :......|||:|.:.:
  Fly    31 IRTMPSFHRT--------------RIIGGSDAEITSHPWMAYLY-----NEFHYFCAGTLITNQF 76

  Fly    80 ILTAAHCL-TTDYVEIHYGSNWGW---NGAFRQSVRRDNFIS----HPNW-PAEGGRDIGLIR-T 134
            :||||||: .:..:.:..|.: |.   :|:..|....|..:|    |..: |:....||.:|| .
  Fly    77 VLTAAHCIEASKNLTVRLGGS-GLTRSDGSMCQITAEDYSVSMAIKHKYFTPSIMLNDIAMIRLA 140

  Fly   135 PSVGFTDLINKVALPSFSEESDRFV---DTWCVACGWGGMDNGNLADWLQCMDVQIISNSECEQS 196
            .:|.|.|.|..:.:  ..:.:.|.:   ....:|.|||..|.......||...:.:::.:.|.:.
  Fly   141 RTVKFYDHIRPICI--ILDPAVRLLLEDGMTLMATGWGLADKRMHPHLLQEAPITVMNRNVCSKL 203

  Fly   197 Y------GTVASTDMCTRRTDGKSSCGGDSGGPL----VTHDNARLV--GVITFGSVDCHSGPSG 249
            |      |.:.:.|..|      ::|.|||||||    ..:.:.|.|  |:.:||.::|.| ||.
  Fly   204 YDVAITQGQICAGDKET------NTCLGDSGGPLGGVVNYYGDLRFVQYGITSFGDIECRS-PSI 261

  Fly   250 YTRVTDYLGWI 260
            ||.::.|.|||
  Fly   262 YTDLSTYSGWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 66/245 (27%)
Tryp_SPc 40..263 CDD:238113 67/246 (27%)
CG43335NP_001247121.1 Tryp_SPc 41..272 CDD:214473 66/245 (27%)
Tryp_SPc 42..275 CDD:238113 67/246 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435865
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.