DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18179 and CG43124

DIOPT Version :9

Sequence 1:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001247345.1 Gene:CG43124 / 12798282 FlyBaseID:FBgn0262587 Length:245 Species:Drosophila melanogaster


Alignment Length:241 Identity:51/241 - (21%)
Similarity:89/241 - (36%) Gaps:68/241 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 VNGYPAPEGKAPYIVGLLIRTDGSNSAAVGAGTIIASDWILTAAHCL-TTDYVEIHYGSNWGWNG 104
            :||    ...||::..:|     |:|..:.||.:|.:.::||||.|. ..:.:.:..||     |
  Fly    34 ING----SSYAPWLAEIL-----SDSKVICAGALINNLYVLTAASCFKENEKLTVRLGS-----G 84

  Fly   105 AFRQSVRRDNF--------ISHPNWPAEGGRDIGLIRTPS-VGFTDLINKVALPSFSEESDRFVD 160
            .|.:|.  :||        ::|  :||....::.:.|..: |.|...|..:.:.. |.:|.....
  Fly    85 YFDKSY--ENFRVTKAYFWMTH--FPANNTNNLCIFRLQTEVEFKTHIRPMCITK-SPKSLGLAT 144

  Fly   161 TWCVACGWGGMDNGNLADWLQCMDVQII-------SNSECEQSYGTVASTDMCTRRTDGKSSCGG 218
            |:.:.       |.....|..|.:::.:       .|.|..||..|                   
  Fly   145 TFEII-------NEKPKMWYFCKNIKGLFCKYVFGENEEKWQSKPT------------------- 183

  Fly   219 DSGGPLV-THDNARLVGVITFGSV---DCHSGPSGYTRVTDYLGWI 260
              |.|.. |..|....|::.:|.:   |..:....|..|..::.||
  Fly   184 --GSPWTETISNGPFKGLVRYGILSYRDNKTYDEVYINVMSHINWI 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 49/239 (21%)
Tryp_SPc 40..263 CDD:238113 51/241 (21%)
CG43124NP_001247345.1 Tryp_SPc 41..>133 CDD:304450 26/105 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.