DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18179 and Ctrl

DIOPT Version :9

Sequence 1:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_446461.1 Gene:Ctrl / 117184 RGDID:621501 Length:264 Species:Rattus norvegicus


Alignment Length:281 Identity:84/281 - (29%)
Similarity:143/281 - (50%) Gaps:33/281 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LFLLTLSVALAVVAASPGFNRTSLLPQVTISEGAEGRIVNGYPAPEGKAPYIVGLLIRTDGSNSA 67
            :.||:|:::|.::.:|.|....::.|.::.::    |||||..|..|..|:.|.|   .|.:...
  Rat     1 MLLLSLTLSLVLLGSSWGCGVPAITPALSYNQ----RIVNGENAVPGSWPWQVSL---QDNTGFH 58

  Fly    68 AVGAGTIIASDWILTAAHCLTTDYVEIHYGSNWGWNGAFRQSVRRD--------NFISHPNW-PA 123
            ..| |::||.:|::|||||..|.      |.::...|.:.:|...:        ..|:||:| |.
  Rat    59 FCG-GSLIAPNWVVTAAHCKVTP------GRHFVILGEYDRSSNAEPIQVLSISKAITHPSWNPN 116

  Fly   124 EGGRDIGLIRTPS-VGFTDLINKVALPSFSEESDRFVDTWCVACGWGGMDN-GNLAD-WLQCMDV 185
            ....|:.|::..| ..:|..::.|.|.|.:|...  ....||..|||.:.. ||:.. .||.:.:
  Rat   117 TMNNDLTLLKLASPARYTAQVSPVCLASSNEALP--AGLTCVTTGWGRISGVGNVTPARLQQVVL 179

  Fly   186 QIISNSECEQSYGTVASTDMCTRRTDGKSSCGGDSGGPLVTHDNAR--LVGVITFGSVDCH-SGP 247
            .:::.::|.|.:|:..:..|......|.|||.||||||||......  |:|::::|:.:|: ..|
  Rat   180 PLVTVNQCRQYWGSRITDSMICAGGAGASSCQGDSGGPLVCQKGNTWVLIGIVSWGTENCNVQAP 244

  Fly   248 SGYTRVTDYLGWIRDNTGISY 268
            :.||||:.:..||  |..|:|
  Rat   245 AMYTRVSKFNTWI--NQVIAY 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 72/235 (31%)
Tryp_SPc 40..263 CDD:238113 73/237 (31%)
CtrlNP_446461.1 Tryp_SPc 33..257 CDD:214473 72/235 (31%)
Tryp_SPc 34..260 CDD:238113 74/239 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.