DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18179 and zgc:163079

DIOPT Version :9

Sequence 1:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001077051.2 Gene:zgc:163079 / 100006550 ZFINID:ZDB-GENE-030131-7428 Length:313 Species:Danio rerio


Alignment Length:250 Identity:71/250 - (28%)
Similarity:112/250 - (44%) Gaps:32/250 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RIVNGYPAPEGKAPYIVGLLIRTDGSNSAAVGAGTIIASDWILTAAHCL----TTDYVEIHYGSN 99
            :|:.|..|.:|..|:...:.::   :.......|::|...|:||.|...    .:|.| ::.|..
Zfish    35 KIIGGLNATQGSWPWQASINLK---ATEEFYCGGSLINKGWVLTTAKVFALMPASDIV-VYLGRQ 95

  Fly   100 WGWNGAFRQSVRR--DNFISHPNWPAEGGRDIGLIRTPS-VGFTDLINKVALPSFSEESDRFVD- 160
             ..||:....:.|  ...|.|||:.:... ::.|::..| |.|:|.|..|.|   :.....||| 
Zfish    96 -TQNGSNPYEISRTVTKIIKHPNYNSLDS-NLALLKLSSPVTFSDYIKPVCL---AAAGSVFVDG 155

  Fly   161 --TWCVACGWGGMDNG------NLADWLQCMDVQIISNSECEQSYGTVASTD-MCT--RRTDGKS 214
              :|  ..|||.::..      .|.|.||.::..|::|.||..:||.:.:.. :|.  ...|||:
Zfish   156 TASW--VTGWGYLNRPATVEEIMLPDVLQEVEAPIVNNFECNAAYGGIITNKLLCAGYLNEDGKA 218

  Fly   215 SCGGDSGGPLVTHDNARLV--GVITFGSVDCHSGPSGYTRVTDYLGWIRDNTGIS 267
            .|.||.|||||....|..:  ||:..|.......|:.|.||::|..||...|..|
Zfish   219 PCAGDVGGPLVIKQGAIWIQSGVVVSGYCGLPGYPTIYVRVSEYEDWISYYTNSS 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 67/241 (28%)
Tryp_SPc 40..263 CDD:238113 69/243 (28%)
zgc:163079NP_001077051.2 Tryp_SPc 35..266 CDD:214473 67/241 (28%)
Tryp_SPc 36..267 CDD:238113 68/241 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.