DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18179 and LOC100004427

DIOPT Version :9

Sequence 1:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster
Sequence 2:XP_005163955.1 Gene:LOC100004427 / 100004427 -ID:- Length:302 Species:Danio rerio


Alignment Length:246 Identity:73/246 - (29%)
Similarity:112/246 - (45%) Gaps:35/246 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RIVNGYPAPEGKAPYIVGLLIRTDGSNSAAVGAGTIIASDWILTAAHC---LTTDYVEIHYGSNW 100
            :||.|..|.||..|:...:..::.|....   :|::|:..|:||||.|   :....|.|:.|   
Zfish    35 KIVGGLNATEGSWPWQASINFKSTGQFFC---SGSLISERWVLTAASCFQRINVSDVVIYLG--- 93

  Fly   101 GWNGAFRQSVRRDNFISHPNWPAEGG--RDIGLIR-TPSVGFTDLINKVALPSFSEESDRFVD-- 160
                  |.:....|....|....:..  .||.|:: :.||.|||.|..|.|   :.....|||  
Zfish    94 ------RLTTNGSNPYEIPRTVIQVSVTEDIALVQLSSSVTFTDYIRPVCL---AAAGSVFVDGT 149

  Fly   161 -TWCVACGWGGMDNGN--LADWLQCMDVQIISNSECEQSYGTVASTD--MCTR--RTDGKSSCGG 218
             :|  ..|||...:.|  |:|.|:.::..|::|.||....| :.:.|  :|..  ...||:.|..
Zfish   150 ESW--VTGWGSTSSTNVILSDMLKEVEAPIVNNIECSNING-ITNLDNVICAGFVNETGKAPCWE 211

  Fly   219 DSGGPLVTHDNARLV--GVITFGSVDCHSGPSGYTRVTDYLGWIRDNTGIS 267
            |.|.||||...::.:  ||:.|.....:..|:.|.||::|..|||:.|..|
Zfish   212 DFGSPLVTRQGSQWIQSGVVVFTFCGQNGFPTLYARVSEYEEWIRNYTSSS 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 68/237 (29%)
Tryp_SPc 40..263 CDD:238113 71/239 (30%)
LOC100004427XP_005163955.1 Tryp_SPc 35..255 CDD:214473 68/237 (29%)
Tryp_SPc 36..257 CDD:238113 70/238 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.